• Gene id: 4295

Gene Summary

• Gene Symbol: MLN   Gene   UCSC   Ensembl
• Gene name: motilin
• Alternate names: promotilin, prepromotilin,
• Gene location: 6p21.31 (33804002: 33794672)     Exons: 22     NC_000006.12
• Gene summary(Entrez): This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as mo
• OMIM: 158270

Protein Summary

• Protein general information: P12872  
  • Name: Promotilin [Cleaved into: Motilin; Motilin associated peptide (MAP)]
  • Length: 115  
  • Mass: 12920
• Sequence:

  MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENE
  MIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK

• Structural information:
  • Interpro: IPR006737  IPR006738  IPR015662  
  • PDB: 1LBJ
  • PDBsum: 1LBJ
  • STRING: ENSP00000388825
• Other Databases: GeneCards:  MLN  Malacards:  MLN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031788	motilin receptor binding	IBA	molecular function
GO:0006939	smooth muscle contraction	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0031788	motilin receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881