• Gene id: 4294

Gene Summary

• Gene Symbol: MAP3K10   Gene   UCSC   Ensembl
• Aliases: MEKK10, MLK2, MST
• Gene name: mitogen-activated protein kinase kinase kinase 10
• Alternate names: mitogen-activated protein kinase kinase kinase 10, MKN28 derived nonreceptor_type serine/threonine kinase, MKN28 kinase, mixed lineage kinase 2, protein kinase MST,
• Gene location: 19q13.2 (40191425: 40215574)     Exons: 12     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase has been shown to activate MAPK8/JNK and MKK4/SEK1, and this kinase itself can be phoshorylated, and thus activated by JNK kinases. This kinase functions prefe
• OMIM: 609594

Protein Summary

• Protein general information: Q02779  
  • Name: Mitogen activated protein kinase kinase kinase 10 (EC 2.7.11.25) (Mixed lineage kinase 2) (Protein kinase MST)
  • Length: 954  
  • Mass: 103694
  • Tissue specificity: Expressed in brain and skeletal muscle.
• Sequence:

  MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNY
  VAPGAPAAPAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPEKDPAVTAEQVCQEARLFG
  ALQHPNIIALRGACLNPPHLCLVMEYARGGALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKS
  INILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
  VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVIEQSALFQMPLESFHS
  LQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLRRREQELAEREMDIVERELHLLMCQLSQEKP
  RVRKRKGNFKRSRLLKLREGGSHISLPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGG
  SSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHT
  PIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVPLPAEPSPGARAPWEPTPSAPPARWGHGARRRCDLAL
  LGCATLLGAVGLGADVAEARAADGEEQRRWLDGLFFPRAGRFPRGLSPPARPHGRREDVGPGLGLAPSATLVSLS
  SVSDCNSTRSLLRSDSDEAAPAAPSPPPSPPAPTPTPSPSTNPLVDLELESFKKDPRQSLTPTHVTAACAVSRGH
  RRTPSDGALGQRGPPEPAGHGPGPRDLLDFPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWK
  LVSFGRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH

• Structural information:
  • Protein Domains: (16..8-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (98..36-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR015785  IPR035779  IPR016231  IPR000719   IPR017441  IPR001245  IPR008271  IPR036028  IPR001452  
  • Prosite: PS00107 PS50011 PS00108 PS50002
  • CDD: cd12059
  • PDB: 2RF0
  • PDBsum: 2RF0
  • STRING: ENSP00000253055
• Other Databases: GeneCards:  MAP3K10  Malacards:  MAP3K10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007257	activation of JUN kinase activity	IBA	biological process
GO:0004672	protein kinase activity	IBA	molecular function
GO:0004706	JUN kinase kinase kinase activity	IBA	molecular function
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0006915	apoptotic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007254	JNK cascade	TAS	biological process
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0008219	cell death	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0007256	activation of JNKK activity	IEA	biological process
GO:0007256	activation of JNKK activity	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0007257	activation of JUN kinase activity	ISS	biological process
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0043507	positive regulation of JUN kinase activity	IMP	biological process
GO:0004706	JUN kinase kinase kinase activity	ISS	molecular function
GO:0003714	transcription corepressor activity	ISS	molecular function
GO:0046777	protein autophosphorylation	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0043425	bHLH transcription factor binding	IPI	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0007224	smoothened signaling pathway	IMP	biological process
GO:0007257	activation of JUN kinase activity	IBA	biological process
GO:0004672	protein kinase activity	IBA	molecular function
GO:0004706	JUN kinase kinase kinase activity	IBA	molecular function
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0006915	apoptotic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007254	JNK cascade	TAS	biological process
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0008219	cell death	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0007256	activation of JNKK activity	IEA	biological process
GO:0007256	activation of JNKK activity	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0007257	activation of JUN kinase activity	ISS	biological process
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0043507	positive regulation of JUN kinase activity	IMP	biological process
GO:0004706	JUN kinase kinase kinase activity	ISS	molecular function
GO:0003714	transcription corepressor activity	ISS	molecular function
GO:0046777	protein autophosphorylation	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0043425	bHLH transcription factor binding	IPI	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0007224	smoothened signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray