• Gene id: 4281

Gene Summary

• Gene Symbol: MID1   Gene   UCSC   Ensembl
• Aliases: BBBG1, FXY, GBBB1, MIDIN, OGS1, OS, OSX, RNF59, TRIM18, XPRF, ZNFXY
• Gene name: midline 1
• Alternate names: E3 ubiquitin-protein ligase Midline-1, Opitz/BBB syndrome, RING finger protein 59, RING finger protein Midline-1, RING-type E3 ubiquitin transferase Midline-1, midline 1 RING finger protein, putative transcription factor XPRF, tripartite motif protein TRIM18, tri,
• Gene location: Xp22.2 (10833682: 10445309)     Exons: 16     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also known as the 'RING-B box-coiled coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box

Protein Summary

• Protein general information: O15344  
  • Name: E3 ubiquitin protein ligase Midline 1 (EC 2.3.2.27) (Midin) (Putative transcription factor XPRF) (RING finger protein 59) (RING finger protein Midline 1) (RING type E3 ubiquitin transferase Midline 1) (Tripartite motif containing protein 18)
  • Length: 667  
  • Mass: 75251
  • Tissue specificity: In the fetus, highest expression found in kidney, followed by brain and lung. Expressed at low levels in fetal liver. In the adult, most abundant in heart, placenta and brain.
• Sequence:

  METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCRHVITLSQRGLDGLKR
  NVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATH
  PNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLES
  NLTNLIKRNTELETLLAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIA
  NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFDTFALDFSREKKLLEC
  LDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTIFTGQANVVSLCNSADSWMIVPNIKQNHYTV
  HGLQSGTKYIFMVKAINQAGSRSSEPGKLKTNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQ
  GSYGVAGNVFIDSGRHYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPH
  LRRVGILLDYDNGSIAFYDALNSIHLYTFDVAFAQPVCPTFTVWNKCLTIITGLPIPDHLDCTEQLP

• Structural information:
  • Protein Domains: (320..37-)
    (/note="COS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00586-)
    (381..48-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (482..65-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR001870  IPR003649  IPR003879  IPR013320  IPR017903   IPR003961  IPR036116  IPR013783  IPR027727  IPR040859  IPR006574  IPR003877  IPR027370  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS51262 PS50853 PS50119 PS00518 PS50089
  • CDD: cd00021 cd00063
  • PDB: 2DQ5 2FFW 2JUN 5IM8
  • PDBsum: 2DQ5 2FFW 2JUN 5IM8
  • STRING: ENSP00000312678
• Other Databases: GeneCards:  MID1  Malacards:  MID1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005881	cytoplasmic microtubule	IDA	colocalizes with
GO:0032874	positive regulation of stress-activated MAPK cascade	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0000226	microtubule cytoskeleton organization	TAS	biological process
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0007389	pattern specification process	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0007026	negative regulation of microtubule depolymerization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005874	microtubule	IDA	cellular component
GO:0035372	protein localization to microtubule	IMP	biological process
GO:0051219	phosphoprotein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0008017	microtubule binding	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Opitz-GBBB syndrome	KEGG:H00583
Opitz-GBBB syndrome	KEGG:H00583
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881