About Us

Search Result


Gene id 4259
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol MGST3   Gene   UCSC   Ensembl
Aliases GST-III
Gene name microsomal glutathione S-transferase 3
Alternate names microsomal glutathione S-transferase 3, LTC4 synthase MGST3, glutathione peroxidase MGST3, microsomal GST-3, microsomal GST-III, microsomal glutathione S-transferase III,
Gene location 1q24.1 (165631233: 165656135)     Exons: 7     NC_000001.11
Gene summary(Entrez) This gene encodes a member of the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) protein family. Members of this family are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation.
OMIM 604564

Protein Summary

Protein general information O14880  

Name: Microsomal glutathione S transferase 3 (Microsomal GST 3) (Glutathione peroxidase MGST3) (EC 1.11.1. ) (LTC4 synthase MGST3) (EC 4.4.1.20) (Microsomal glutathione S transferase III) (Microsomal GST III)

Length: 152  Mass: 16516

Tissue specificity: Predominantly expressed in heart, skeletal muscle, and adrenal cortex. Also found in brain, placenta, liver, kidney, pancreas, thyroid, testis and ovary. Almost absent in lung, thymus and peripheral blood leukocytes. {ECO

Sequence MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFL
AVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKC
CH
Structural information
Interpro:  IPR023352  IPR001129  
STRING:   ENSP00000356864
Other Databases GeneCards:  MGST3  Malacards:  MGST3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0004602 glutathione peroxidase ac
tivity
IBA molecular function
GO:0005635 nuclear envelope
IBA cellular component
GO:0005783 endoplasmic reticulum
IBA cellular component
GO:0005783 endoplasmic reticulum
IEA cellular component
GO:0016829 lyase activity
IEA molecular function
GO:0043231 intracellular membrane-bo
unded organelle
IEA cellular component
GO:0016740 transferase activity
IEA molecular function
GO:0055114 oxidation-reduction proce
ss
IEA biological process
GO:0016491 oxidoreductase activity
IEA molecular function
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0004464 leukotriene-C4 synthase a
ctivity
IEA molecular function
GO:1901687 glutathione derivative bi
osynthetic process
TAS biological process
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular component
GO:0006805 xenobiotic metabolic proc
ess
TAS biological process
GO:0042802 identical protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0004602 glutathione peroxidase ac
tivity
IEA molecular function
GO:0010243 response to organonitroge
n compound
IEA biological process
GO:0004464 leukotriene-C4 synthase a
ctivity
IDA molecular function
GO:0004364 glutathione transferase a
ctivity
IDA NOT|molecular function
GO:0004602 glutathione peroxidase ac
tivity
IDA molecular function
GO:0043231 intracellular membrane-bo
unded organelle
IDA cellular component
GO:0006629 lipid metabolic process
IDA biological process
GO:0016020 membrane
IDA cellular component
GO:0019370 leukotriene biosynthetic
process
IDA biological process
GO:0005789 endoplasmic reticulum mem
brane
IEA cellular component
GO:0031090 organelle membrane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0098869 cellular oxidant detoxifi
cation
IEA biological process
GO:0098869 cellular oxidant detoxifi
cation
IEA biological process
GO:0098869 cellular oxidant detoxifi
cation
IEA biological process
GO:0016020 membrane
HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa01100Metabolic pathways
hsa05200Pathways in cancer
hsa05225Hepatocellular carcinoma
hsa05418Fluid shear stress and atherosclerosis
hsa00983Drug metabolism - other enzymes
hsa05204Chemical carcinogenesis
hsa00980Metabolism of xenobiotics by cytochrome P450
hsa00982Drug metabolism - cytochrome P450
hsa01524Platinum drug resistance
hsa00480Glutathione metabolism
Associated diseases References
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract