• Gene id: 4258

Gene Summary

• Gene Symbol: MGST2   Gene   UCSC   Ensembl
• Aliases: GST2, MGST-II
• Gene name: microsomal glutathione S-transferase 2
• Alternate names: microsomal glutathione S-transferase 2, microsomal GST-2, microsomal GST-II,
• Gene location: 4q31.1 (139665724: 139754607)     Exons: 10     NC_000004.12
• Gene summary(Entrez): The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene en
• OMIM: 601733

Protein Summary

• Protein general information: Q99735  
  • Name: Microsomal glutathione S transferase 2 (Microsomal GST 2) (EC 2.5.1.18) (Microsomal GST II)
  • Length: 147  
  • Mass: 16621
  • Tissue specificity: Liver, spleen, skeletal muscle, heart, adrenals, pancreas, prostate, testis, fetal liver, and fetal spleen. Very low expression in lung, brain, placenta and bone marrow.
• Sequence:

  MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMAGWYFN
  QVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF

• Structural information:
  • Interpro: IPR001446  IPR018295  IPR023352  IPR001129  
  • Prosite: PS01297
  • STRING: ENSP00000482639
• Other Databases: GeneCards:  MGST2  Malacards:  MGST2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0004602	glutathione peroxidase activity	IBA	molecular function
GO:0005635	nuclear envelope	IBA	cellular component
GO:0019370	leukotriene biosynthetic process	IBA	biological process
GO:0004464	leukotriene-C4 synthase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0043295	glutathione binding	IDA	molecular function
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0006691	leukotriene metabolic process	IEA	biological process
GO:0008047	enzyme activator activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0019370	leukotriene biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004464	leukotriene-C4 synthase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0004464	leukotriene-C4 synthase activity	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0004464	leukotriene-C4 synthase activity	IDA	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0046466	membrane lipid catabolic process	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0050729	positive regulation of inflammatory response	NAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0006629	lipid metabolic process	IDA	biological process
GO:0019370	leukotriene biosynthetic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0019370	leukotriene biosynthetic process	IDA	biological process
GO:0019370	leukotriene biosynthetic process	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0006750	glutathione biosynthetic process	IDA	biological process
GO:0004464	leukotriene-C4 synthase activity	IDA	molecular function
GO:0004464	leukotriene-C4 synthase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa01524	Platinum drug resistance
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881