• Gene id: 4257

Gene Summary

• Gene Symbol: MGST1   Gene   UCSC   Ensembl
• Aliases: GST12, MGST, MGST-I
• Gene name: microsomal glutathione S-transferase 1
• Alternate names: microsomal glutathione S-transferase 1, glutathione S-transferase 12, microsomal GST-1, microsomal GST-I,
• Gene location: 12p12.3 (35230723: 35048755)     Exons: 16     NC_000005.10
• Gene summary(Entrez): The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family mem
• OMIM: 138330

Protein Summary

• Protein general information: P10620  
  • Name: Microsomal glutathione S transferase 1 (Microsomal GST 1) (EC 2.5.1.18) (Microsomal GST I)
  • Length: 155  
  • Mass: 17,599
• Sequence:

  MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA
  HLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGVTLSMAYRLLK
  SKLYL

• Structural information:
  • Interpro: IPR023352  IPR001129  
  • STRING: ENSP00000010404
• Other Databases: GeneCards:  MGST1  Malacards:  MGST1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006749	glutathione metabolic process	IEA	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0016021	integral component of membrane	ISS	cellular component
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0033327	Leydig cell differentiation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0043295	glutathione binding	IEA	molecular function
GO:0045177	apical part of cell	IEA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0070207	protein homotrimerization	ISS	biological process
GO:0071449	cellular response to lipid hydroperoxide	IDA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	ISS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006749	glutathione metabolic process	IEA	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	ISS	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0033327	Leydig cell differentiation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043295	glutathione binding	IEA	molecular function
GO:0045177	apical part of cell	IEA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0070207	protein homotrimerization	IEA	biological process
GO:0070207	protein homotrimerization	ISS	biological process
GO:0071449	cellular response to lipid hydroperoxide	IDA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005778	peroxisomal membrane	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0016021	integral component of membrane	ISS	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0070207	protein homotrimerization	ISS	biological process
GO:0071449	cellular response to lipid hydroperoxide	IDA	biological process
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05204	Chemical carcinogenesis
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Cancer	GAD: 17483957
Cancer (colorectal)	GAD: 17483957
Macular degeneration	GAD: 16384981
Macular degeneration	GAD: 16384981
Pancreatitis	GAD: 15338373
Male factor infertility	MIK: 15120973
Male factor infertility	MIK: 15120973
Chronic renal failure	GAD: 21085059
Male infertility	MIK: 15120973
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15120973	Male infertility			8 testis biopsies	Male infertility	Vim Rad23A Rad23B Gsr Gstp 1 Mgst1 Ace Casp1 Ctsd Prlr Tmsb4 and Zfp-37 Hsp 1 Osp94
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)