• Gene id: 4248

Gene Summary

• Gene Symbol: MGAT3   Gene   UCSC   Ensembl
• Aliases: GNT-III, GNT3
• Gene name: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
• Alternate names: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GlcNAc-T III, N-acetylglucosaminyltransferase III, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosami,
• Gene location: 22q13.1 (39457011: 39492193)     Exons: 2     NC_000022.11
• Gene summary(Entrez): There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. The enzyme encoded by this gene transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of
• OMIM: 600983

Protein Summary

• Protein general information: Q09327  
  • Name: Beta 1,4 mannosyl glycoprotein 4 beta N acetylglucosaminyltransferase (EC 2.4.1.144) (N glycosyl oligosaccharide glycoprotein N acetylglucosaminyltransferase III) (GNT III) (GlcNAc T III) (N acetylglucosaminyltransferase III)
  • Length: 533  
  • Mass: 61313
• Sequence:

  MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQASPEPGGPDLLRTPLY
  SHSPLLQPLPPSKAAEELHRVDLVLPEDTTEYFVRTKAGGVCFKPGTKMLERPPPGRPEEKPEGANGSSARRPPR
  YLLSARERTGGRGARRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRF
  HELGDVVDAFVVCESNFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPPGGRQDGWIADDYLRTFLTQDG
  VSRLRNLRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYGFFWKQPGTLEVVSGCTVDMLQAVYG
  LDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKR
  DLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPAR
  GKLDEAEV

• Structural information:
  • Interpro: IPR006813  
  • STRING: ENSP00000345270
• Other Databases: GeneCards:  MGAT3  Malacards:  MGAT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016757	transferase activity, transferring glycosyl groups	IBA	molecular function
GO:0006044	N-acetylglucosamine metabolic process	IBA	biological process
GO:0030334	regulation of cell migration	IDA	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:1905166	negative regulation of lysosomal protein catabolic process	ISS	biological process
GO:1902966	positive regulation of protein localization to early endosome	ISS	biological process
GO:0050435	amyloid-beta metabolic process	ISS	biological process
GO:0003830	beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	ISS	molecular function
GO:0050890	cognition	ISS	biological process
GO:0006487	protein N-linked glycosylation	ISS	biological process
GO:0008104	protein localization	IMP	biological process
GO:0003830	beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	IMP	molecular function
GO:0003830	beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0006487	protein N-linked glycosylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0003830	beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0003830	beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq