• Gene id: 4247

Gene Summary

• Gene Symbol: MGAT2   Gene   UCSC   Ensembl
• Aliases: CDG2A, CDGS2, GLCNACTII, GNT-II, GNT2
• Gene name: alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
• Alternate names: alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase, Beta-1,2-N-acetylglucosaminyltransferase II, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II, UDP-N-acetylglucosamine:alpha-6-D-mannoside beta-1,2-N-acetylgluc,
• Gene location: 14q21.3 (49620798: 49623480)     Exons: 1     NC_000014.9
• Gene summary(Entrez): The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable sign

Protein Summary

• Protein general information: Q10469  
  • Name: Alpha 1,6 mannosyl glycoprotein 2 beta N acetylglucosaminyltransferase (EC 2.4.1.143) (Beta 1,2 N acetylglucosaminyltransferase II) (GlcNAc T II) (GNT II) (Mannoside acetylglucosaminyltransferase 2) (N glycosyl oligosaccharide glycoprotein N acetylglucosa
  • Length: 447  
  • Mass: 51550
• Sequence:

  MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSVAVGIRRVSNVSAASL
  VPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVI
  FSHDFWSTEINQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREA
  KFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
  YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQIPRIFHA
  GDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVVAISPPRKNGGWGDIRDHELCKSYRRLQ

• Structural information:
  • Interpro: IPR007754  IPR029044  
  • PDB: 5VCM 5VCR 5VCS
  • PDBsum: 5VCM 5VCR 5VCS
  • STRING: ENSP00000307423
• Other Databases: GeneCards:  MGAT2  Malacards:  MGAT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	IBA	molecular function
GO:0000139	Golgi membrane	IBA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0000139	Golgi membrane	IDA	cellular component
GO:0030145	manganese ion binding	IDA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	IDA	biological process
GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	IDA	biological process
GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	IMP	biological process
GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	IMP	molecular function
GO:0005795	Golgi stack	IEA	cellular component
GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0009312	oligosaccharide biosynthetic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	IEA	biological process
GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0008455	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0006487	protein N-linked glycosylation	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Congenital disorders of glycosylation type II	KEGG:H00119
Congenital disorders of glycosylation type II	KEGG:H00119
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881