• Gene id: 4241

Gene Summary

• Gene Symbol: MELTF   Gene   UCSC   Ensembl
• Aliases: CD228, MAP97, MFI2, MTF1, MTf
• Gene name: melanotransferrin
• Alternate names: melanotransferrin, antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5, melanoma-associated antigen p97, membrane-bound transferrin-like protein,
• Gene location: 3q29 (197029816: 197001739)     Exons: 18     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a cell-surface glycoprotein found on melanoma cells. The protein shares sequence similarity and iron-binding properties with members of the transferrin superfamily. The importance of the iron binding function has not ye
• OMIM: 603576

Protein Summary

• Protein general information: P08582  
  • Name: Melanotransferrin (Melanoma associated antigen p97) (CD antigen CD228)
  • Length: 738  
  • Mass: 80215
  • Tissue specificity: Found predominantly in human melanomas and in certain fetal tissues; also found in liver, epithelium, umbilical chord, placenta and sweat gland ducts.
• Sequence:

  MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQEADAI
  TLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGWNVPVGYLVES
  GRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVA
  FVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQ
  RLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLHAMKGLLCDPNRLPPYLRWCVLSTPE
  IQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTLSGEDIYTAGKTYGLVPAAGEHYAPEDSSNS
  YYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPK
  NYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYE
  LLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKD
  ATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQCSGAAAPAPGAPLLPLLLPALAARLLPPAL

• Structural information:
  • Protein Domains: (23..35-)
    (/note="Transferrin-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00741-)
    (366..70-)
    (/note="Transferrin-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00741"-)
  • Interpro: IPR016357  IPR001156  IPR018195  
  • Prosite: PS00205 PS00206 PS00207 PS51408
  • STRING: ENSP00000296350
• Other Databases: GeneCards:  MELTF  Malacards:  MELTF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0005506	iron ion binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:0090091	positive regulation of extracellular matrix disassembly	IDA	biological process
GO:0010756	positive regulation of plasminogen activation	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0006826	iron ion transport	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042127	regulation of cell population proliferation	IMP	NOT|biological process
GO:0001558	regulation of cell growth	IMP	NOT|biological process
GO:0005506	iron ion binding	IMP	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq