• Gene id: 4218

Gene Summary

• Gene Symbol: RAB8A   Gene   UCSC   Ensembl
• Aliases: MEL, RAB8
• Gene name: RAB8A, member RAS oncogene family
• Alternate names: ras-related protein Rab-8A, mel transforming oncogene (RAB8 homolog), mel transforming oncogene (derived from cell line NK14), mel transforming oncogene (derived from cell line NK14)- RAB8 homolog, oncogene c-mel, ras-associated protein RAB8,
• Gene location: 19p13.11 (16111888: 16134233)     Exons: 8     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endo
• OMIM: 123580

Protein Summary

• Protein general information: P61006  
  • Name: Ras related protein Rab 8A (Oncogene c mel)
  • Length: 207  
  • Mass: 23668
• Sequence:

  MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITT
  AYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMET
  SAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • PDB: 3QBT 3TNF 4LHV 4LHW 4LHX 4LHY 4LHZ 4LI0 5SZI
  • PDBsum: 3QBT 3TNF 4LHV 4LHW 4LHX 4LHY 4LHZ 4LI0 5SZI
  • DIP: 43703
  • STRING: ENSP00000300935
• Other Databases: GeneCards:  RAB8A  Malacards:  RAB8A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097730	non-motile cilium	IDA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006904	vesicle docking involved in exocytosis	IBA	biological process
GO:0009306	protein secretion	IBA	biological process
GO:0043197	dendritic spine	IBA	cellular component
GO:0048210	Golgi vesicle fusion to target membrane	IBA	biological process
GO:0098969	neurotransmitter receptor transport to postsynaptic membrane	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0017157	regulation of exocytosis	IBA	biological process
GO:0030140	trans-Golgi network transport vesicle	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0032869	cellular response to insulin stimulus	IBA	biological process
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0019003	GDP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0005929	cilium	IDA	colocalizes with
GO:0030496	midbody	IDA	cellular component
GO:0072659	protein localization to plasma membrane	ISS	biological process
GO:0060271	cilium assembly	IMP	biological process
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0017137	Rab GTPase binding	ISS	molecular function
GO:0010506	regulation of autophagy	IMP	biological process
GO:0007409	axonogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005929	cilium	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005929	cilium	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097730	non-motile cilium	IEA	cellular component
GO:0097546	ciliary base	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0036064	ciliary basal body	IEA	cellular component
GO:0030140	trans-Golgi network transport vesicle	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0099003	vesicle-mediated transport in synapse	IEA	biological process
GO:0098969	neurotransmitter receptor transport to postsynaptic membrane	IEA	biological process
GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane	IEA	biological process
GO:0051223	regulation of protein transport	IEA	biological process
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0032880	regulation of protein localization	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0097730	non-motile cilium	IDA	cellular component
GO:0060271	cilium assembly	IDA	biological process
GO:0006904	vesicle docking involved in exocytosis	IDA	biological process
GO:0048210	Golgi vesicle fusion to target membrane	IDA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0005929	cilium	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031489	myosin V binding	IPI	molecular function
GO:0060271	cilium assembly	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04530	Tight junction
hsa04140	Autophagy - animal
hsa04152	AMPK signaling pathway
hsa04972	Pancreatic secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq