• Gene id: 4212

Gene Summary

• Gene Symbol: MEIS2   Gene   UCSC   Ensembl
• Aliases: CPCMR, HsT18361, MRG1
• Gene name: Meis homeobox 2
• Alternate names: homeobox protein Meis2, Meis homolog 2, Meis1, myeloid ecotropic viral integration site 1 homolog 2, Meis1-related gene 1, TALE homeobox protein Meis2, meis1-related protein 1,
• Gene location: 15q14 (37101310: 36889203)     Exons: 16     NC_000015.10
• Gene summary(Entrez): This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essen
• OMIM: 601806

Protein Summary

• Protein general information: O14770  
  • Name: Homeobox protein Meis2 (Meis1 related protein 1)
  • Length: 477  
  • Mass: 51790
  • Tissue specificity: Expressed in various tissues. Expressed at high level in the lymphoid organs of hematopoietic tissues. Also expressed in some regions of the brain, such as the putamen.
• Sequence:

  MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKR
  DKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQA
  IQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDAT
  STHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLT
  HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQ
  HMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGM
  TMSAQSPTMLNSVDPNVGGQVMDIHAQ

• Structural information:
  • Interpro: IPR009057  IPR001356  IPR008422  IPR032453  
  • Prosite: PS50071
  • CDD: cd00086
  • PDB: 3K2A 4XRM 5BNG 5EG0
  • PDBsum: 3K2A 4XRM 5BNG 5EG0
  • DIP: 61027
  • STRING: ENSP00000453793
• Other Databases: GeneCards:  MEIS2  Malacards:  MEIS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0001654	eye development	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0007420	brain development	IBA	biological process
GO:0009880	embryonic pattern specification	IBA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0045638	negative regulation of myeloid cell differentiation	ISS	biological process
GO:0008134	transcription factor binding	ISS	molecular function
GO:0003712	transcription coregulator activity	ISS	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0001654	eye development	IEA	biological process
GO:0070848	response to growth factor	IEA	biological process
GO:0031016	pancreas development	IEA	biological process
GO:0110024	positive regulation of cardiac muscle myoblast proliferation	IDA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cleft palate, cardiac defects, and mental retardation	KEGG:H02394
Cleft palate, cardiac defects, and mental retardation	KEGG:H02394
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881