• Gene id: 4211

Gene Summary

• Gene Symbol: MEIS1   Gene   UCSC   Ensembl
• Gene name: Meis homeobox 1
• Alternate names: homeobox protein Meis1, Meis1, myeloid ecotropic viral integration site 1 homolog, WUGSC:H_NH0444B04.1, leukemogenic homolog protein,
• Gene location: 2p14 (66435124: 66573868)     Exons: 13     NC_000002.12
• Gene summary(Entrez): Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the T
• OMIM: 616861

Protein Summary

• Protein general information: O00470  
  • Name: Homeobox protein Meis1
  • Length: 390  
  • Mass: 43016
  • Tissue specificity: Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also ex
• Sequence:

  MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDK
  DAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQ
  VLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRS
  GGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP
  SEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMS
  GMGMNMGMEGQWHYM

• Structural information:
  • Interpro: IPR009057  IPR001356  IPR008422  IPR032453  
  • Prosite: PS50071
  • CDD: cd00086
  • PDB: 4XRS 5EGO
  • PDBsum: 4XRS 5EGO
  • STRING: ENSP00000272369
• Other Databases: GeneCards:  MEIS1  Malacards:  MEIS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0001525	angiogenesis	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0001654	eye development	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0007420	brain development	IBA	biological process
GO:0009880	embryonic pattern specification	IBA	biological process
GO:0030097	hemopoiesis	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0045638	negative regulation of myeloid cell differentiation	ISS	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060044	negative regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0060216	definitive hemopoiesis	IEA	biological process
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0007626	locomotory behavior	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IEA	biological process
GO:0035855	megakaryocyte development	IEA	biological process
GO:0030097	hemopoiesis	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0002089	lens morphogenesis in camera-type eye	IEA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881