• Gene id: 4199

Gene Summary

• Gene Symbol: ME1   Gene   UCSC   Ensembl
• Aliases: HUMNDME, MES
• Gene name: malic enzyme 1
• Alternate names: NADP-dependent malic enzyme, Malic enzyme, cytoplasmic, NADP-ME, malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)), malic enzyme 1, NADP(+)-dependent, cytosolic, malic enzyme 1, soluble, pyruvic-malic carboxylase,
• Gene location: 6q14.2 (35662691: 35818006)     Exons: 5     NC_000011.10
• Gene summary(Entrez): This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expressi
• OMIM: 154250

Protein Summary

• Protein general information: P48163  
  • Name: NADP dependent malic enzyme (NADP ME) (EC 1.1.1.40) (Malic enzyme 1)
  • Length: 572  
  • Mass: 64150
  • Tissue specificity: Expressed in all tissues tested including liver, placenta and white adipose tissue. {ECO
• Sequence:

  MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLL
  MDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVV
  TDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFL
  DEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQ
  GAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTA
  LIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPG
  QGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEK
  TATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ

• Structural information:
  • Interpro: IPR015884  IPR012301  IPR037062  IPR012302  IPR001891   IPR036291  
  • Prosite: PS00331
  • PDB: 2AW5 3WJA
  • PDBsum: 2AW5 3WJA
  • STRING: ENSP00000358719
• Other Databases: GeneCards:  ME1  Malacards:  ME1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004470	malic enzyme activity	IMP	molecular function
GO:1902031	regulation of NADP metabolic process	IMP	biological process
GO:0004473	malate dehydrogenase (decarboxylating) (NADP+) activity	IBA	molecular function
GO:0004470	malic enzyme activity	IBA	molecular function
GO:0006108	malate metabolic process	IBA	biological process
GO:0006090	pyruvate metabolic process	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0004470	malic enzyme activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004471	malate dehydrogenase (decarboxylating) (NAD+) activity	IEA	molecular function
GO:0051287	NAD binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005975	carbohydrate metabolic process	NAS	biological process
GO:0004473	malate dehydrogenase (decarboxylating) (NADP+) activity	IEA	molecular function
GO:0008948	oxaloacetate decarboxylase activity	IEA	molecular function
GO:0006090	pyruvate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0004473	malate dehydrogenase (decarboxylating) (NADP+) activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0022900	electron transport chain	IEA	biological process
GO:0004473	malate dehydrogenase (decarboxylating) (NADP+) activity	IDA	molecular function
GO:0006108	malate metabolic process	IDA	biological process
GO:0006108	malate metabolic process	IDA	biological process
GO:0030145	manganese ion binding	IDA	molecular function
GO:0004470	malic enzyme activity	IDA	molecular function
GO:0004470	malic enzyme activity	IDA	molecular function
GO:0009743	response to carbohydrate	TAS	biological process
GO:0051287	NAD binding	TAS	molecular function
GO:0043531	ADP binding	TAS	molecular function
GO:0009725	response to hormone	ISS	biological process
GO:0050661	NADP binding	TAS	molecular function
GO:0009165	nucleotide biosynthetic process	TAS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0004473	malate dehydrogenase (decarboxylating) (NADP+) activity	ISS	molecular function
GO:0009055	electron transfer activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa03320	PPAR signaling pathway
hsa00620	Pyruvate metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq