Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 4193
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol MDM2   Gene   UCSC   Ensembl
Aliases ACTFS, HDMX, hdm2
Gene name MDM2 proto-oncogene
Alternate names E3 ubiquitin-protein ligase Mdm2, MDM2 oncogene, E3 ubiquitin protein ligase, MDM2 proto-oncogene, E3 ubiquitin protein ligase, Mdm2, p53 E3 ubiquitin protein ligase homolog, Mdm2, transformed 3T3 cell double minute 2, p53 binding protein, double minute 2,
Gene location 12q15 (68808148: 68845543)     Exons: 13     NC_000012.12
Gene summary(Entrez) This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpres
OMIM 164785

SNPs
rs937283

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.68808384A>G
NC_000012.11   g.69202164A>G
NG_016708.1   g.5194A>G
NM_002392.5   c.-94A>G
NM_001145339.2   c.-94A>G
XM_006719400.4   c.-281A>G|SEQ=[A/G]|GENE=MDM2

Protein Summary
Protein general information Q00987  

Name: E3 ubiquitin protein ligase Mdm2 (EC 2.3.2.27) (Double minute 2 protein) (Hdm2) (Oncoprotein Mdm2) (RING type E3 ubiquitin transferase Mdm2) (p53 binding protein Mdm2)

Length: 491  Mass: 55,233

Tissue specificity: Expressed in a variety of organs, but most strongly in adult testis and ovary followed by small intestine, colon, prostate, thymus, spleen, pancreas, skeletal muscle, heart, brain and kidney. Also expressed in umbilical vein endothelia

Sequence MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIV
YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSS
HLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLD
AGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCV
EENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCI
VHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Structural information
Protein Domains
 SWIB. (27-107)
Interpro:  IPR028340  IPR015459  IPR016495  IPR036885  IPR003121  
IPR001876  IPR036443  IPR001841  IPR013083  
Prosite:   PS01358 PS50199 PS50089

PDB:  		 1RV1 1T4E 1T4F 1YCR 1Z1M 2AXI 2C6A 2C6B 2F1Y 2FOP 2GV2 2HDP 2LZG 2M86 2MPS 2RUH 2VJE 2VJF 3EQS 3G03 3IUX 3IWY 3JZK 3JZR 3JZS 3LBK 3LBL 3LNJ 3LNZ 3MQS 3TJ2 3TPX 3TU1 3V3B 3VBG 3VZV 3W69 4DIJ 4ERE 4ERF 4HBM 4HFZ 4HG7 4JV7 4JV9 4JVE 4JVR 4JWR 4MDN 4MDQ 4OAS
PDBsum:   1RV1 1T4E 1T4F 1YCR 1Z1M 2AXI 2C6A 2C6B 2F1Y 2FOP 2GV2 2HDP 2LZG 2M86 2MPS 2RUH 2VJE 2VJF 3EQS 3G03 3IUX 3IWY 3JZK 3JZR 3JZS 3LBK 3LBL 3LNJ 3LNZ 3MQS 3TJ2 3TPX 3TU1 3V3B 3VBG 3VZV 3W69 4DIJ 4ERE 4ERF 4HBM 4HFZ 4HG7 4JV7 4JV9 4JVE 4JVR 4JWR 4MDN 4MDQ 4OAS

DIP:  
392
MINT:  
STRING:   ENSP00000417281
Other Databases GeneCards:  MDM2  Malacards:  MDM2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological process
GO:0001568 blood vessel development
 IEA biological process
GO:0001974 blood vessel remodeling
 IEA biological process
GO:0002027 regulation of heart rate
 IEA biological process
GO:0002039 p53 binding
 IPI molecular function
GO:0002039 p53 binding
 IPI molecular function
GO:0002039 p53 binding
 IPI molecular function
GO:0003181 atrioventricular valve mo
rphogenesis
 IEA biological process
GO:0003203 endocardial cushion morph
ogenesis
 IEA biological process
GO:0003281 ventricular septum develo
pment
 IEA biological process
GO:0003283 atrial septum development
 IEA biological process
GO:0004842 ubiquitin-protein transfe
rase activity
 IMP molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 IDA molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IMP cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005730 nucleolus
 IDA cellular component
GO:0005730 nucleolus
 IDA cellular component
GO:0005737 cytoplasm
 IMP cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006461 protein complex assembly
 IDA biological process
GO:0006461 protein complex assembly
 IDA biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 IMP biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological process
GO:0007089 traversing start control
point of mitotic cell cyc
le
 IEA biological process
GO:0008270 zinc ion binding
 IDA molecular function
GO:0008284 positive regulation of ce
ll proliferation
 TAS biological process
GO:0009743 response to carbohydrate
 IEA biological process
GO:0010039 response to iron ion
 IEA biological process
GO:0010628 positive regulation of ge
ne expression
 IEA biological process
GO:0010955 negative regulation of pr
otein processing
 IEA biological process
GO:0016032 viral process
 IEA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016874 ligase activity
 IDA molecular function
GO:0016925 protein sumoylation
 TAS biological process
GO:0018205 peptidyl-lysine modificat
ion
 IMP biological process
GO:0019789 SUMO transferase activity
 EXP molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0031648 protein destabilization
 IDA biological process
GO:0031648 protein destabilization
 IDA biological process
GO:0032026 response to magnesium ion
 IEA biological process
GO:0032436 positive regulation of pr
oteasomal ubiquitin-depen
dent protein catabolic pr
ocess
 IDA biological process
GO:0034504 protein localization to n
ucleus
 IDA biological process
GO:0042176 regulation of protein cat
abolic process
 IDA biological process
GO:0042220 response to cocaine
 IEA biological process
GO:0042493 response to drug
 IEA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IDA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IDA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IMP biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042975 peroxisome proliferator a
ctivated receptor binding
 IEA molecular function
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IEA biological process
GO:0043234 protein complex
 IDA cellular component
GO:0043278 response to morphine
 IEA biological process
GO:0043518 negative regulation of DN
A damage response, signal
transduction by p53 clas
s mediator
 IDA biological process
GO:0043518 negative regulation of DN
A damage response, signal
transduction by p53 clas
s mediator
 IDA biological process
GO:0045184 establishment of protein
localization
 IDA biological process
GO:0045202 synapse
 IEA cellular component
GO:0045472 response to ether
 IEA biological process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0045931 positive regulation of mi
totic cell cycle
 IMP biological process
GO:0046677 response to antibiotic
 IEP biological process
GO:0046827 positive regulation of pr
otein export from nucleus
 IEA biological process
GO:0060411 cardiac septum morphogene
sis
 IEA biological process
GO:0061630 ubiquitin protein ligase
activity
 IMP molecular function
GO:0061630 ubiquitin protein ligase
activity
 TAS molecular function
GO:0061630 ubiquitin protein ligase
activity
 TAS molecular function
GO:0061630 ubiquitin protein ligase
activity
 TAS molecular function
GO:0070301 cellular response to hydr
ogen peroxide
 IEA biological process
GO:0071157 negative regulation of ce
ll cycle arrest
 IDA biological process
GO:0071236 cellular response to anti
biotic
 IEA biological process
GO:0071301 cellular response to vita
min B1
 IEA biological process
GO:0071312 cellular response to alka
loid
 IEA biological process
GO:0071363 cellular response to grow
th factor stimulus
 IEA biological process
GO:0071375 cellular response to pept
ide hormone stimulus
 IEA biological process
GO:0071391 cellular response to estr
ogen stimulus
 IEA biological process
GO:0071456 cellular response to hypo
xia
 IEP biological process
GO:0071494 cellular response to UV-C
 IEA biological process
GO:0097110 scaffold protein binding
 IEA molecular function
GO:1901796 regulation of signal tran
sduction by p53 class med
iator
 TAS biological process
GO:1901797 negative regulation of si
gnal transduction by p53
class mediator
 IDA biological process
GO:0016604 nuclear body
 IDA cellular component
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological process
GO:0001568 blood vessel development
 IEA biological process
GO:0001974 blood vessel remodeling
 IEA biological process
GO:0002027 regulation of heart rate
 IEA biological process
GO:0002039 p53 binding
 IEA molecular function
GO:0002039 p53 binding
 IPI molecular function
GO:0002039 p53 binding
 IPI molecular function
GO:0002039 p53 binding
 IPI molecular function
GO:0003170 heart valve development
 IEA biological process
GO:0003181 atrioventricular valve mo
rphogenesis
 IEA biological process
GO:0003203 endocardial cushion morph
ogenesis
 IEA biological process
GO:0003281 ventricular septum develo
pment
 IEA biological process
GO:0003283 atrial septum development
 IEA biological process
GO:0004842 ubiquitin-protein transfe
rase activity
 IEA molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 IMP molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 IDA molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IMP cellular component
GO:0005654 nucleoplasm
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005730 nucleolus
 IEA cellular component
GO:0005730 nucleolus
 IEA cellular component
GO:0005730 nucleolus
 IDA cellular component
GO:0005730 nucleolus
 IDA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IMP cellular component
GO:0005829 cytosol
 IEA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006461 protein complex assembly
 IDA biological process
GO:0006461 protein complex assembly
 IDA biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 IMP biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological process
GO:0007089 traversing start control
point of mitotic cell cyc
le
 IEA biological process
GO:0007507 heart development
 IEA biological process
GO:0008270 zinc ion binding
 IEA molecular function
GO:0008270 zinc ion binding
 IDA molecular function
GO:0008284 positive regulation of ce
ll proliferation
 TAS biological process
GO:0009636 response to toxic substan
ce
 IEA biological process
GO:0009743 response to carbohydrate
 IEA biological process
GO:0010039 response to iron ion
 IEA biological process
GO:0010468 regulation of gene expres
sion
 IEA biological process
GO:0010628 positive regulation of ge
ne expression
 IEA biological process
GO:0010629 negative regulation of ge
ne expression
 IEA biological process
GO:0010955 negative regulation of pr
otein processing
 IEA biological process
GO:0016032 viral process
 IEA biological process
GO:0016567 protein ubiquitination
 IEA biological process
GO:0016567 protein ubiquitination
 IEA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016874 ligase activity
 IEA molecular function
GO:0016874 ligase activity
 IDA molecular function
GO:0016925 protein sumoylation
 TAS biological process
GO:0018205 peptidyl-lysine modificat
ion
 IMP biological process
GO:0019789 SUMO transferase activity
 EXP molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0031648 protein destabilization
 IDA biological process
GO:0031648 protein destabilization
 IDA biological process
GO:0032026 response to magnesium ion
 IEA biological process
GO:0032436 positive regulation of pr
oteasomal ubiquitin-depen
dent protein catabolic pr
ocess
 IDA biological process
GO:0034504 protein localization to n
ucleus
 IDA biological process
GO:0042176 regulation of protein cat
abolic process
 IDA biological process
GO:0042220 response to cocaine
 IEA biological process
GO:0042493 response to drug
 IEA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IEA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IDA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IDA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IMP biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042975 peroxisome proliferator a
ctivated receptor binding
 IEA molecular function
GO:0043066 negative regulation of ap
optotic process
 IEA biological process
GO:0043066 negative regulation of ap
optotic process
 IEA biological process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IEA biological process
GO:0043234 protein complex
 IDA cellular component
GO:0043278 response to morphine
 IEA biological process
GO:0043518 negative regulation of DN
A damage response, signal
transduction by p53 clas
s mediator
 IDA biological process
GO:0043518 negative regulation of DN
A damage response, signal
transduction by p53 clas
s mediator
 IDA biological process
GO:0045184 establishment of protein
localization
 IDA biological process
GO:0045202 synapse
 IEA cellular component
GO:0045472 response to ether
 IEA biological process
GO:0045787 positive regulation of ce
ll cycle
 IEA biological process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IEA biological process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0045931 positive regulation of mi
totic cell cycle
 IMP biological process
GO:0046677 response to antibiotic
 IEP biological process
GO:0046827 positive regulation of pr
otein export from nucleus
 IEA biological process
GO:0046872 metal ion binding
 IEA molecular function
GO:0048545 response to steroid hormo
ne
 IEA biological process
GO:0060411 cardiac septum morphogene
sis
 IEA biological process
GO:0061630 ubiquitin protein ligase
activity
 IEA molecular function
GO:0061630 ubiquitin protein ligase
activity
 IMP molecular function
GO:0061630 ubiquitin protein ligase
activity
 TAS molecular function
GO:0061630 ubiquitin protein ligase
activity
 TAS molecular function
GO:0061630 ubiquitin protein ligase
activity
 TAS molecular function
GO:0070301 cellular response to hydr
ogen peroxide
 IEA biological process
GO:0071157 negative regulation of ce
ll cycle arrest
 IEA biological process
GO:0071157 negative regulation of ce
ll cycle arrest
 IDA biological process
GO:0071236 cellular response to anti
biotic
 IEA biological process
GO:0071301 cellular response to vita
min B1
 IEA biological process
GO:0071310 cellular response to orga
nic substance
 IEA biological process
GO:0071312 cellular response to alka
loid
 IEA biological process
GO:0071363 cellular response to grow
th factor stimulus
 IEA biological process
GO:0071375 cellular response to pept
ide hormone stimulus
 IEA biological process
GO:0071391 cellular response to estr
ogen stimulus
 IEA biological process
GO:0071407 cellular response to orga
nic cyclic compound
 IEA biological process
GO:0071456 cellular response to hypo
xia
 IEP biological process
GO:0071494 cellular response to UV-C
 IEA biological process
GO:0097110 scaffold protein binding
 IEA molecular function
GO:1901796 regulation of signal tran
sduction by p53 class med
iator
 TAS biological process
GO:1901797 negative regulation of si
gnal transduction by p53
class mediator
 IDA biological process
GO:0016604 nuclear body
 IDA cellular component
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological process
GO:0002039 p53 binding
 IPI molecular function
GO:0002039 p53 binding
 IPI molecular function
GO:0002039 p53 binding
 IPI molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 IMP molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 IDA molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IMP cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005730 nucleolus
 IDA cellular component
GO:0005730 nucleolus
 IDA cellular component
GO:0005737 cytoplasm
 IMP cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0006461 protein complex assembly
 IDA biological process
GO:0006461 protein complex assembly
 IDA biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 IMP biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological process
GO:0008270 zinc ion binding
 IDA molecular function
GO:0008284 positive regulation of ce
ll proliferation
 TAS biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016567 protein ubiquitination
 IDA biological process
GO:0016874 ligase activity
 IDA molecular function
GO:0016925 protein sumoylation
 TAS biological process
GO:0018205 peptidyl-lysine modificat
ion
 IMP biological process
GO:0019789 SUMO transferase activity
 EXP molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0030666 endocytic vesicle membran
e
 TAS cellular component
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0031648 protein destabilization
 IDA biological process
GO:0031648 protein destabilization
 IDA biological process
GO:0032436 positive regulation of pr
oteasomal ubiquitin-depen
dent protein catabolic pr
ocess
 IDA biological process
GO:0034504 protein localization to n
ucleus
 IDA biological process
GO:0042176 regulation of protein cat
abolic process
 IDA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IDA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IDA biological process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 IMP biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0043234 protein complex
 IDA cellular component
GO:0043518 negative regulation of DN
A damage response, signal
transduction by p53 clas
s mediator
 IDA biological process
GO:0043518 negative regulation of DN
A damage response, signal
transduction by p53 clas
s mediator
 IDA biological process
GO:0045184 establishment of protein
localization
 IDA biological process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0045931 positive regulation of mi
totic cell cycle
 IMP biological process
GO:0046677 response to antibiotic
 IEP biological process
GO:0061630 ubiquitin protein ligase
activity
 IMP molecular function
GO:0061630 ubiquitin protein ligase
activity
 TAS molecular function
GO:0061630 ubiquitin protein ligase
activity
 TAS molecular function
GO:0061630 ubiquitin protein ligase
activity
 TAS molecular function
GO:0071157 negative regulation of ce
ll cycle arrest
 IDA biological process
GO:0071456 cellular response to hypo
xia
 IEP biological process
GO:1901796 regulation of signal tran
sduction by p53 class med
iator
 TAS biological process
GO:1901797 negative regulation of si
gnal transduction by p53
class mediator
 IDA biological process
GO:0016604 nuclear body
 IDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04068FoxO signaling pathway
hsa04151PI3K-Akt signaling pathway
hsa04144Endocytosis
hsa04110Cell cycle
hsa04115p53 signaling pathway
hsa04218Cellular senescence
hsa04625C-type lectin receptor signaling pathway
hsa04919Thyroid hormone signaling pathway
hsa05200Pathways in cancer
hsa05202Transcriptional misregulation in cancer
hsa05206MicroRNAs in cancer
hsa05205Proteoglycans in cancer
hsa05203Viral carcinogenesis
hsa05214Glioma
hsa05220Chronic myeloid leukemia
hsa05218Melanoma
hsa05219Bladder cancer
hsa05215Prostate cancer
hsa05163Human cytomegalovirus infection
hsa05169Epstein-Barr virus infection
hsa05165Human papillomavirus infection
hsa01524Platinum drug resistance
hsa01522Endocrine resistance

Diseases

Expand All | Collapse All
Associated diseases References
Cancer GAD: 19116388
Cancer (bladder) GAD: 17094469
Cancer (brain) GAD: 17527046
Cancer (cervical) GAD: 20200430
Cancer (choroid plexus) GAD: 20308654
Cancer (Chronic B-Cell Leukemias) GAD: 17981213
Cancer (Chronic Lymphocytic Leukemia) GAD: 20089965
Cancer (colorectal) GAD: 16203772
Cancer (endometrial) GAD: 17123590
Cancer (epithelial ovarian) GAD: 19064572
Cancer (leukemia) GAD: 18313915
Leukoplakia GAD: 19204927
Cancer (transitional cell) GAD: 18575717
Neoplasm GAD: 19526525
Cancer (breast) GAD: 16239061
Medulloblastoma KEGG: H01667
Cancer (penile) KEGG: H00025
Osteosarcoma KEGG: H00036
Choriocarcinoma KEGG: H00028
Glioma KEGG: H00042
Retinoblastoma KEGG: H01513
Alveolar rhabdomyosarcoma KEGG: H00037
Cancer (Adenocarcinoma) GAD: 18559624
Cancer (esophageal) GAD: 16230424
Cancer (Hepatocellular) GAD: 18390844
Cancer (liver) GAD: 16914573
Cancer (lung) GAD: 16152608
Cancer (lymphoma) GAD: 19594747
Cancer (melanoma) GAD: 19318491
Cancer (nasopharyngeal) GAD: 20398418
Cancer (Neuroblastoma) GAD: 18519749
Cancer (non-melanoma skin cancer) GAD: 17553029
Cancer (osteosarcoma) GAD: 19451596
Cancer (ovarian) GAD: 21316605
Cancer (pancreas adenocarcinomas) GAD: 19752772
Cancer (prostate) GAD: 18459109
Cancer (Renal cell) GAD: 17634539
Cancer (retinal) GAD: 21051655
Cancer (Squamous cell) GAD: 18423915
Cancer (stomach) GAD: 16983111
Abortion GAD: 20587610
Restenosis GAD: 12082592
Li-Fraumeni syndrome GAD: 16258005
Hodgkin disease GAD: 19573080
Arthritis GAD: 19772793
Crohn's disease GAD: 20110711
Psoriasis GAD: 19779722
Systemic lupus erythematosus (SLE) GAD: 19074170
Chronic renal failure GAD: 21085059
Pregnancy loss GAD: 19246469
Recurrent pregnancy loss (RPL) INFBASE: 25218545
Recurrent pregnancy loss (RPL) INFBASE: 24435975
Male factor infertility MIK: 22773013
Chronic obstructive pulmonary disease (COPD) GAD: 19625176
Wegener granulomatosis GAD: 18799058
Anoxia GAD: 20232446
Occupational diseases GAD: 19596022
Accelerated tumor formation OMIM: 164785
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Male infertility MIK: 22773013
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
22773013 Male infer
tility
 TP53 rs2287498 and MDM2 rs937283 Chinese
 1160 (580 infer
tile patients,
580 fertile con
trols)
 Male infertility TP53
MDM2
 Show abstract
26470726 Male steri
lity

Male infertility
Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract