• Gene id: 4176

Gene Summary

• Gene Symbol: MCM7   Gene   UCSC   Ensembl
• Aliases: CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146, PPP1R104
• Gene name: minichromosome maintenance complex component 7
• Alternate names: DNA replication licensing factor MCM7, CDC47 homolog, homolog of S. cerevisiae Cdc47, minichromosome maintenance deficient 7, protein phosphatase 1, regulatory subunit 104,
• Gene location: 7q22.1 (100101396: 100092727)     Exons: 15     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component
• OMIM: 612823

Protein Summary

• Protein general information: P33993  
  • Name: DNA replication licensing factor MCM7 (EC 3.6.4.12) (CDC47 homolog) (P1.1 MCM3)
  • Length: 719  
  • Mass: 81308
• Sequence:

  MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAK
  LFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQGPSSNKPRVIR
  EVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTR
  GSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
  HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNI
  NICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKM
  AEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRP
  DRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
  TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSV
  RFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

• Structural information:
  • Protein Domains: (332..53-)
    (/note="MCM"-)
  • Interpro: IPR003593  IPR031327  IPR008050  IPR018525  IPR001208   IPR041562  IPR027925  IPR033762  IPR012340  IPR027417  
  • Prosite: PS00847 PS50051
  • DIP: 27580
  • STRING: ENSP00000307288
• Other Databases: GeneCards:  MCM7  Malacards:  MCM7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	TAS	contributes to
GO:0042555	MCM complex	IMP	cellular component
GO:0042325	regulation of phosphorylation	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006270	DNA replication initiation	IEA	biological process
GO:0042555	MCM complex	IEA	cellular component
GO:0006271	DNA strand elongation involved in DNA replication	IBA	biological process
GO:0006268	DNA unwinding involved in DNA replication	IBA	biological process
GO:0003688	DNA replication origin binding	IBA	molecular function
GO:1990518	single-stranded 3'-5' DNA helicase activity	IBA	contributes to
GO:0042555	MCM complex	IBA	cellular component
GO:0006270	DNA replication initiation	IBA	biological process
GO:0006267	pre-replicative complex assembly involved in nuclear cell cycle DNA replication	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000727	double-strand break repair via break-induced replication	IBA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0004386	helicase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000785	chromatin	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0006268	DNA unwinding involved in DNA replication	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008283	cell population proliferation	IEA	biological process
GO:0071466	cellular response to xenobiotic stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IEA	biological process
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003678	DNA helicase activity	IDA	contributes to
GO:0042555	MCM complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa03030	DNA replication

Diseases

Associated diseases	References
pancreatic ductal carcinoma	PMID:15548371
hepatocellular carcinoma	PMID:27298561
hepatocellular carcinoma	PMID:24416400
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray