• Gene id: 4175

Gene Summary

• Gene Symbol: MCM6   Gene   UCSC   Ensembl
• Aliases: MCG40308, Mis5, P105MCM
• Gene name: minichromosome maintenance complex component 6
• Alternate names: DNA replication licensing factor MCM6, MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe), minichromosome maintenance deficient (mis5, S. pombe) 6,
• Gene location: 2q21.3 (135876442: 135839625)     Exons: 17     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component

Protein Summary

• Protein general information: Q14566  
  • Name: DNA replication licensing factor MCM6 (EC 3.6.4.12) (p105MCM)
  • Length: 821  
  • Mass: 92889
• Sequence:

  MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNTLVVSFVDLEQFNQQL
  STTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPE
  LVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLE
  VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
  CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGG
  VPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALM
  LADNGVCCIDEFDKMDVRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAP
  IMSRFDLFFILVDECNEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
  LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEIQME
  VDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVN
  WYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

• Structural information:
  • Protein Domains: (346..55-)
    (/note="MCM"-)
  • Interpro: IPR031327  IPR008049  IPR041024  IPR018525  IPR001208   IPR041562  IPR027925  IPR033762  IPR012340  IPR027417  
  • Prosite: PS00847 PS50051
  • PDB: 2KLQ 2LE8
  • PDBsum: 2KLQ 2LE8
  • DIP: 31727
  • STRING: ENSP00000264156
• Other Databases: GeneCards:  MCM6  Malacards:  MCM6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902969	mitotic DNA replication	IBA	biological process
GO:0006268	DNA unwinding involved in DNA replication	IBA	biological process
GO:0003688	DNA replication origin binding	IBA	molecular function
GO:1990518	single-stranded 3'-5' DNA helicase activity	IBA	contributes to
GO:0042555	MCM complex	IBA	cellular component
GO:0006267	pre-replicative complex assembly involved in nuclear cell cycle DNA replication	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000727	double-strand break repair via break-induced replication	IBA	biological process
GO:0003678	DNA helicase activity	IDA	contributes to
GO:0042555	MCM complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006270	DNA replication initiation	IEA	biological process
GO:0042555	MCM complex	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0004386	helicase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0006268	DNA unwinding involved in DNA replication	IEA	biological process
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006260	DNA replication	NAS	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0005524	ATP binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa03030	DNA replication

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881