• Gene id: 4173

Gene Summary

• Gene Symbol: MCM4   Gene   UCSC   Ensembl
• Aliases: CDC21, CDC54, IMD54, NKCD, NKGCD, P1-CDC21, hCdc21
• Gene name: minichromosome maintenance complex component 4
• Alternate names: DNA replication licensing factor MCM4, homolog of S. pombe cell devision cycle 21, minichromosome maintenance deficient 4,
• Gene location: 8q11.21 (47960940: 47978159)     Exons: 16     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of t
• OMIM: 602435

Protein Summary

• Protein general information: P33991  
  • Name: DNA replication licensing factor MCM4 (EC 3.6.4.12) (CDC21 homolog) (P1 CDC21)
  • Length: 863  
  • Mass: 96558
• Sequence:

  MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQSPAAQDVLFSSPPQM
  HSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKL
  VIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQ
  LISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
  EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAH
  NDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLK
  ELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYN
  LVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
  AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEE
  QAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLS
  NKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFE
  DIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVRLL

• Structural information:
  • Protein Domains: (458..66-)
    (/note="MCM"-)
  • Interpro: IPR031327  IPR008047  IPR018525  IPR001208  IPR041562   IPR027925  IPR033762  IPR012340  IPR027417  
  • Prosite: PS00847 PS50051
  • DIP: 31729
  • STRING: ENSP00000262105
• Other Databases: GeneCards:  MCM4  Malacards:  MCM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902975	mitotic DNA replication initiation	IBA	biological process
GO:0042555	MCM complex	IBA	cellular component
GO:0006267	pre-replicative complex assembly involved in nuclear cell cycle DNA replication	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000727	double-strand break repair via break-induced replication	IBA	biological process
GO:0006271	DNA strand elongation involved in DNA replication	IBA	biological process
GO:0006268	DNA unwinding involved in DNA replication	IBA	biological process
GO:0003688	DNA replication origin binding	IBA	molecular function
GO:0003678	DNA helicase activity	IDA	contributes to
GO:0042555	MCM complex	IDA	cellular component
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006270	DNA replication initiation	IEA	biological process
GO:0042555	MCM complex	IEA	cellular component
GO:0004386	helicase activity	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006260	DNA replication	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0006268	DNA unwinding involved in DNA replication	IEA	biological process
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0006260	DNA replication	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa03030	DNA replication

Diseases

Associated diseases	References
Immunodeficiency associated with DNA repair defects	KEGG:H00094
Immunodeficiency associated with DNA repair defects	KEGG:H00094
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray