• Gene id: 4172

Gene Summary

• Gene Symbol: MCM3   Gene   UCSC   Ensembl
• Aliases: HCC5, P1-MCM3, P1.h, RLFB
• Gene name: minichromosome maintenance complex component 3
• Alternate names: DNA replication licensing factor MCM3, DNA polymerase alpha holoenzyme-associated protein P1, DNA replication factor MCM3, MCM3 minichromosome maintenance deficient 3, RLF subunit beta, cervical cancer proto-oncogene 5, hRlf beta subunit, minichromosome maintena,
• Gene location: 6p12.2 (52284741: 52264014)     Exons: 20     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the
• OMIM: 602693

Protein Summary

• Protein general information: P25205  
  • Name: DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme associated protein P1) (P1 MCM3) (RLF subunit beta) (p102)
  • Length: 808  
  • Mass: 90981
• Sequence:

  MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVA
  FQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPA
  TKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDL
  VDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLA
  KSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSG
  VGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLA
  AANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVD
  ILATDDPNFSQEDQQDTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQ
  DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETE
  DEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVA
  LLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI

• Structural information:
  • Protein Domains: (295..50-)
    (/note="MCM"-)
  • Interpro: IPR003593  IPR031327  IPR008046  IPR018525  IPR001208   IPR041562  IPR027925  IPR033762  IPR012340  IPR027417  
  • Prosite: PS00847 PS50051
  • DIP: 31726
  • STRING: ENSP00000480987
• Other Databases: GeneCards:  MCM3  Malacards:  MCM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006271	DNA strand elongation involved in DNA replication	IBA	biological process
GO:0003688	DNA replication origin binding	IBA	molecular function
GO:1902975	mitotic DNA replication initiation	IBA	biological process
GO:0042555	MCM complex	IBA	cellular component
GO:0006267	pre-replicative complex assembly involved in nuclear cell cycle DNA replication	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000727	double-strand break repair via break-induced replication	IBA	biological process
GO:0042555	MCM complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006270	DNA replication initiation	IEA	biological process
GO:0042555	MCM complex	IEA	cellular component
GO:0004386	helicase activity	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0005658	alpha DNA polymerase:primase complex	TAS	cellular component
GO:0006270	DNA replication initiation	TAS	biological process
GO:0003678	DNA helicase activity	IEA	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0032508	DNA duplex unwinding	IEA	biological process
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa03030	DNA replication

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray