• Gene id: 4155

Gene Summary

• Gene Symbol: MBP   Gene   UCSC   Ensembl
• Gene name: myelin basic protein
• Alternate names: myelin basic protein, Golli-MBP, proline-rich proteoglycan 2, myelin A1 protein, myelin membrane encephalitogenic protein,
• Gene location: 18q23 (77133707: 76978832)     Exons: 17     NC_000018.10
• Gene summary(Entrez): The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs ar
• OMIM: 159430

Protein Summary

• Protein general information: P02686  
  • Name: Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)
  • Length: 304  
  • Mass: 33117
  • Tissue specificity: MBP isoforms are found in both the central and the peripheral nervous system, whereas Golli-MBP isoforms are expressed in fetal thymus, spleen and spinal cord, as well as in cell lines derived from the immune system. {ECO
• Sequence:

  MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKN
  AWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLA
  TASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFK
  NIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSP
  MARR

• Structural information:
  • Interpro: IPR000548  
  • Prosite: PS00569
  • PDB: 1BX2 1FV1 1HQR 1K2D 1QCL 1YMM 1ZGL
  • PDBsum: 1BX2 1FV1 1HQR 1K2D 1QCL 1YMM 1ZGL
  • DIP: 36624
  • STRING: ENSP00000380958
• Other Databases: GeneCards:  MBP  Malacards:  MBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	ISS	cellular component
GO:0043025	neuronal cell body	IBA	cellular component
GO:0033269	internode region of axon	IBA	cellular component
GO:0071944	cell periphery	IBA	cellular component
GO:0043218	compact myelin	IBA	cellular component
GO:0042552	myelination	IBA	biological process
GO:0019911	structural constituent of myelin sheath	IBA	molecular function
GO:0019911	structural constituent of myelin sheath	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007417	central nervous system development	TAS	biological process
GO:0008366	axon ensheathment	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002020	protease binding	IEA	molecular function
GO:0007605	sensory perception of sound	IEA	biological process
GO:0033269	internode region of axon	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0009636	response to toxic substance	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0042552	myelination	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0043218	compact myelin	IEA	cellular component
GO:0061024	membrane organization	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:1904685	positive regulation of metalloendopeptidase activity	IDA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:0035633	maintenance of blood-brain barrier	IDA	biological process
GO:0005516	calmodulin binding	IPI	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0043209	myelin sheath	IDA	cellular component
GO:1904209	positive regulation of chemokine (C-X-C motif) ligand 2 production	IDA	biological process
GO:0000165	MAPK cascade	IDA	biological process
GO:0034115	negative regulation of heterotypic cell-cell adhesion	IDA	biological process
GO:0021762	substantia nigra development	HEP	biological process

Diseases

Associated diseases	References
Multiple sclerosis	PMID:1691612
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray