• Gene id: 4151

Gene Summary

• Gene Symbol: MB   Gene   UCSC   Ensembl
• Aliases: PVALB
• Gene name: myoglobin
• Alternate names: myoglobin,
• Gene location: 22q12.3 (35623353: 35606763)     Exons: 6     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxyg
• OMIM: 605897

Protein Summary

• Protein general information: P02144  
  • Name: Myoglobin
  • Length: 154  
  • Mass: 17184
• Sequence:

  MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGG
  ILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKEL
  GFQG

• Structural information:
  • Interpro: IPR000971  IPR009050  IPR012292  IPR002335  
  • Prosite: PS01033
  • PDB: 3RGK
  • PDBsum: 3RGK
  • STRING: ENSP00000380489
• Other Databases: GeneCards:  MB  Malacards:  MB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015671	oxygen transport	IBA	biological process
GO:0019825	oxygen binding	IBA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0019825	oxygen binding	IEA	molecular function
GO:0005344	oxygen carrier activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0015671	oxygen transport	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0043353	enucleate erythrocyte differentiation	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0031444	slow-twitch skeletal muscle fiber contraction	IEA	biological process
GO:0019825	oxygen binding	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0015671	oxygen transport	IBA	biological process
GO:0019825	oxygen binding	IBA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0019825	oxygen binding	IEA	molecular function
GO:0005344	oxygen carrier activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0015671	oxygen transport	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0043353	enucleate erythrocyte differentiation	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0031444	slow-twitch skeletal muscle fiber contraction	IEA	biological process
GO:0019825	oxygen binding	IEA	molecular function
GO:0015671	oxygen transport	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq