• Gene id: 4145

Gene Summary

• Gene Symbol: MATK   Gene   UCSC   Ensembl
• Aliases: CHK, CTK, HHYLTK, HYL, HYLTK, Lsk
• Gene name: megakaryocyte-associated tyrosine kinase
• Alternate names: megakaryocyte-associated tyrosine-protein kinase, CSK homologous kinase, Csk-homologous kinase, Csk-type protein tyrosine kinase, HYL tyrosine kinase, hematopoietic consensus tyrosine-lacking kinase, hydroxyaryl-protein kinase, leukocyte carboxyl-terminal src ki,
• Gene location: 19p13.3 (3801798: 3777972)     Exons: 17     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack

Protein Summary

• Protein general information: P42679  
  • Name: Megakaryocyte associated tyrosine protein kinase (EC 2.7.10.2) (CSK homologous kinase) (CHK) (Hematopoietic consensus tyrosine lacking kinase) (Protein kinase HYL) (Tyrosine protein kinase CTK)
  • Length: 507  
  • Mass: 56469
  • Tissue specificity: Expressed in various myeloid cell lines, detected in brain and lung.
• Sequence:

  MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFRKGDVV
  TILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESA
  RHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELAR
  AGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGL
  YIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAK
  AERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCP
  GPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP

• Structural information:
  • Protein Domains: (48..11-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (122..21-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (235..48-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR035027  IPR011009  IPR000719  IPR017441  IPR001245   IPR000980  IPR036860  IPR036028  IPR001452  IPR008266  IPR020635  
  • Prosite: PS00107 PS50011 PS00109 PS50001 PS50002
  • CDD: cd09937
  • PDB: 1JWO 1X6G 3US4
  • PDBsum: 1JWO 1X6G 3US4
  • STRING: ENSP00000378485
• Other Databases: GeneCards:  MATK  Malacards:  MATK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04722	Neurotrophin signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R