• Gene id: 414301

Gene Summary

• Gene Symbol: DDI1   Gene   UCSC   Ensembl
• Gene name: DNA damage inducible 1 homolog 1
• Alternate names: protein DDI1 homolog 1, DDI1, DNA-damage inducible 1, homolog 1, DNA-damage inducible protein 1,
• Gene location: 11q22.3 (104036639: 104039195)     Exons: 1     NC_000011.10
• OMIM: 610550

Protein Summary

• Protein general information: Q8WTU0  
  • Name: Protein DDI1 homolog 1 (EC 3.4.23. )
  • Length: 396  
  • Mass: 44124
• Sequence:

  MLITVYCVRRDLSEVTFSLQVSPDFELRNFKVLCEAESRVPVEEIQIIHMERLLIEDHCSLGSYGLKDGDIVVLL
  QKDNVGPRAPGRAPNQPRVDFSGIAVPGTSSSRPQHPGQQQQRTPAAQRSQGLASGEKVAGLQGLGSPALIRSML
  LSNPHDLSLLKERNPPLAEALLSGSLETFSQVLMEQQREKALREQERLRLYTADPLDREAQAKIEEEIRQQNIEE
  NMNIAIEEAPESFGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIG
  RVHLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLPEGELPLCSRMVSG
  QDESSDKEITHSVMDSGRKEH

• Structural information:
  • Protein Domains: (1..8-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR019103  IPR021109  IPR000626  IPR029071  
  • Prosite: PS50053
  • CDD: cd05479
  • PDB: 3S8I
  • PDBsum: 3S8I
  • DIP: 60626
  • STRING: ENSP00000302805
• Other Databases: GeneCards:  DDI1  Malacards:  DDI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010498	proteasomal protein catabolic process	IMP	biological process
GO:0097752	regulation of DNA stability	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0072711	cellular response to hydroxyurea	IMP	biological process
GO:0004190	aspartic-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0004190	aspartic-type endopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray