• Gene id: 4143

Gene Summary

• Gene Symbol: MAT1A   Gene   UCSC   Ensembl
• Aliases: MAT, MATA1, SAMS, SAMS1
• Gene name: methionine adenosyltransferase 1A
• Alternate names: S-adenosylmethionine synthase isoform type-1, MAT 1, MAT-I/III, S-adenosylmethionine synthetase isoform type-1, adoMet synthase 1, adoMet synthetase 1, methionine adenosyltransferase 1, methionine adenosyltransferase I, alpha, methionine adenosyltransferase I/III,
• Gene location: 10q22.3 (80289657: 80271819)     Exons: 9     NC_000010.11
• Gene summary(Entrez): This gene catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl gro
• OMIM: 600038

Protein Summary

• Protein general information: Q00266  
  • Name: S adenosylmethionine synthase isoform type 1 (AdoMet synthase 1) (EC 2.5.1.6) (Methionine adenosyltransferase 1) (MAT 1) (Methionine adenosyltransferase I/III) (MAT I/III)
  • Length: 395  
  • Mass: 43648
  • Tissue specificity: Expressed in liver. {ECO
• Sequence:

  MNGPVDGLCDHSLSEGVFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGEITSMA
  MVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCVHLDRNEEDVGAGDQGLMFGYATDETEECM
  PLTIILAHKLNARMADLRRSGLLPWLRPDSKTQVTVQYMQDNGAVIPVRIHTIVISVQHNEDITLEEMRRALKEQ
  VIRAVVPAKYLDEDTVYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARW
  VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVHKNFDLRPGVIVRDLDLKKPIYQKTA
  CYGHFGRSEFPWEVPRKLVF

• Structural information:
  • Interpro: IPR022631  IPR022630  IPR022629  IPR022628  IPR002133   IPR022636  
  • Prosite: PS00376 PS00377
  • PDB: 2OBV
  • PDBsum: 2OBV
  • STRING: ENSP00000361287
• Other Databases: GeneCards:  MAT1A  Malacards:  MAT1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004478	methionine adenosyltransferase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006556	S-adenosylmethionine biosynthetic process	IBA	biological process
GO:0004478	methionine adenosyltransferase activity	IDA	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0009087	methionine catabolic process	IMP	biological process
GO:0006556	S-adenosylmethionine biosynthetic process	IMP	biological process
GO:0004478	methionine adenosyltransferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006556	S-adenosylmethionine biosynthetic process	IEA	biological process
GO:0006730	one-carbon metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004478	methionine adenosyltransferase activity	IEA	molecular function
GO:0000096	sulfur amino acid metabolic process	TAS	biological process
GO:0001887	selenium compound metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0032259	methylation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006556	S-adenosylmethionine biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01230	Biosynthesis of amino acids
hsa00270	Cysteine and methionine metabolism

Diseases

Associated diseases	References
Hypermethioninemia	KEGG:H00184
Hypermethioninemia	KEGG:H00184
Hypermethioninemia	PMID:9042912
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq