• Gene id: 4142

Gene Summary

• Gene Symbol: MAS1   Gene   UCSC   Ensembl
• Aliases: MAS, MGRA
• Gene name: MAS1 proto-oncogene, G protein-coupled receptor
• Alternate names: proto-oncogene Mas, MAS1 oncogene, Mas-related G protein-coupled receptor A,
• Gene location: 6q25.3 (159906941: 159908075)     Exons: 1     NC_000006.12
• Gene summary(Entrez): This gene encodes a class I seven-transmembrane G-protein-coupled receptor. The encoded protein is a receptor for angiotensin-(1-7) and preferentially couples to the Gq protein, activating the phospholipase C signaling pathway. The encoded protein may pla
• OMIM: 165180

Protein Summary

• Protein general information: P04201  
  • Name: Proto oncogene Mas
  • Length: 325  
  • Mass: 37,465
• Sequence:

  MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFRMRRNPFTVYITHLSI
  ADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGLYLLTAISVERCLSVLYPIWYRCHRPKYQSA
  LVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSK
  LYIVIMVTIIIFLIFAMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT
  RAFKDEMQPRRQKDNCNTVTVETVV

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR026234  IPR000820  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000252660
• Other Databases: GeneCards:  MAS1  Malacards:  MAS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001595	angiotensin receptor activity	ISS	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0004930	G-protein coupled receptor activity	IDA	molecular function
GO:0004945	angiotensin type II receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0014823	response to activity	IEA	biological process
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0021766	hippocampus development	IEA	biological process
GO:0034698	response to gonadotropin	IEA	biological process
GO:0038166	angiotensin-activated signaling pathway	IEA	biological process
GO:0042277	peptide binding	ISS	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0060732	positive regulation of inositol phosphate biosynthetic process	IEA	biological process
GO:0070528	protein kinase C signaling	IMP	biological process
GO:0001595	angiotensin receptor activity	IEA	molecular function
GO:0001595	angiotensin receptor activity	ISS	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IDA	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0004945	angiotensin type II receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0014823	response to activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0021766	hippocampus development	IEA	biological process
GO:0034698	response to gonadotropin	IEA	biological process
GO:0038166	angiotensin-activated signaling pathway	IEA	biological process
GO:0042277	peptide binding	IEA	molecular function
GO:0042277	peptide binding	ISS	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0060732	positive regulation of inositol phosphate biosynthetic process	IEA	biological process
GO:0070528	protein kinase C signaling	IMP	biological process
GO:0071375	cellular response to peptide hormone stimulus	IEA	biological process
GO:0001595	angiotensin receptor activity	ISS	molecular function
GO:0004930	G-protein coupled receptor activity	IDA	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0004945	angiotensin type II receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G-protein coupled receptor signaling pathway	TAS	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0042277	peptide binding	ISS	molecular function
GO:0070528	protein kinase C signaling	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa00564	Glycerophospholipid metabolism
hsa03015	mRNA surveillance pathway
hsa04080	Neuroactive ligand-receptor interaction
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
Celiac disease	GAD: 19240061
Diabetes	GAD: 20592051
Polycystic ovary syndrome (PCOS)	INFBASE: 24169251
Non obstructive azoospermia	MIK: 20361351
Spermatogenesis defects	MIK: 20361351
Male infertility	MIK: 20361351
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20361351	Male infertility, impaired spermatogenesis (non-obstructive azoospermia)			20 (8 with obstructive azoospermia/normal spermatogenesis, 12 with non-obstructive azoospermia and severely impaired spermatogenesis)	Male infertility	Mas
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R