• Gene id: 4135

Gene Summary

• Gene Symbol: MAP6   Gene   UCSC   Ensembl
• Aliases: MAP6-N, MTAP6, N-STOP, STOP
• Gene name: microtubule associated protein 6
• Alternate names: microtubule-associated protein 6, CTD-2530H12.7, MAP-6, stable tubule-only polypeptide,
• Gene location: 11q13.5 (75668723: 75586913)     Exons: 10     NC_000011.10
• Gene summary(Entrez): This gene encodes a microtubule-associated protein. The encoded protein is a calmodulin-binding and calmodulin-regulated protein that is involved in microtubule stabilization. Two transcript variants encoding distinct isoforms have been identified for thi
• OMIM: 601783

Protein Summary

• Protein general information: Q96JE9  
  • Name: Microtubule associated protein 6 (MAP 6) (Stable tubule only polypeptide) (STOP)
  • Length: 813  
  • Mass: 86505
  • Tissue specificity: Expressed in brain (at protein level). Expressed in spinal cord. Isoform 2 expression is up-regulated in the prefrontal cortex (Brodmann's area 46) of patients with schizophrenia (postmortem brain study). {ECO
• Sequence:

  MAWPCITRACCIARFWNQLDKADIAVPLVFTKYSEATEHPGAPPQPPPPQQQAQPALAPPSARAVAIETQPAQGE
  LDAVARATGPAPGPTGEREPAAGPGRSGPGPGLGSGSTSGPADSVMRQDYRAWKVQRPEPSCRPRSEYQPSDAPF
  ERETQYQKDFRAWPLPRRGDHPWIPKPVQISAASQASAPILGAPKRRPQSQERWPVQAAAEAREQEAAPGGAGGL
  AAGKASGADERDTRRKAGPAWIVRRAEGLGHEQTPLPAAQAQVQATGPEAGRGRAAADALNRQIREEVASAVSSS
  YRNEFRAWTDIKPVKPIKAKPQYKPPDDKMVHETSYSAQFKGEASKPTTADNKVIDRRRIRSLYSEPFKEPPKVE
  KPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTKPDDKEQSKEMNNKLAEAKESLAQPVSDSSK
  TQGPVATEPDKDQGSVVPGLLKGQGPMVQEPLKKQGSVVPGPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAP
  VKDQGPSVPVPPKNQSPMVPAKVKDQGSVVPESLKDQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVS
  APVKDQGPIVPAPVKGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSMVSEPVKNQGLV
  VSGPVKDQDVVVPEHAKVHDSAVVAPVKNQGPVVPESVKNQDPILPVLVKDQGPTVLQPPKNQGRIVPEPLKNQV
  PIVPVPLKDQDPLVPVPAKDQGPAVPEPLKTQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP

• Structural information:
  • Interpro: IPR007882  
  • STRING: ENSP00000307093
• Other Databases: GeneCards:  MAP6  Malacards:  MAP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050772	positive regulation of axonogenesis	IBA	biological process
GO:0048813	dendrite morphogenesis	IBA	biological process
GO:0030705	cytoskeleton-dependent intracellular transport	IBA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0008017	microtubule binding	IBA	molecular function
GO:0005801	cis-Golgi network	IBA	cellular component
GO:0005798	Golgi-associated vesicle	IBA	cellular component
GO:0070507	regulation of microtubule cytoskeleton organization	IBA	biological process
GO:0005874	microtubule	IBA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0048813	dendrite morphogenesis	IMP	biological process
GO:0032418	lysosome localization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray