• Gene id: 4134

Gene Summary

• Gene Symbol: MAP4   Gene   UCSC   Ensembl
• Gene name: microtubule associated protein 4
• Alternate names: microtubule-associated protein 4, MAP-4,
• Gene location: 3p21.31 (180650297: 180601505)     Exons: 35     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MA
• OMIM: 157132

Protein Summary

• Protein general information: P27816  
  • Name: Microtubule associated protein 4 (MAP 4)
  • Length: 1152  
  • Mass: 121005
• Sequence:

  MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIED
  TPSSKPTLLANGGHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWPEDTNFCFQPEQVVDPIQTDPFKMYHDDDLA
  DLVFPSSATADTSIFAGQNDPLKDSYGMSPCNTAVVPQGWSVEALNSPHSESFVSPEAVAEPPQPTAVPLELAKE
  IEMASEERPPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDMQPSMESDM
  ALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTLLKETERASPIKMDLAPSKDMGPPKE
  NKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQANDIISSTEISSAEKVALSSETEVALARDM
  TLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAKDVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPE
  TEVVLIKNVCLPPEMEVALTEDQVPALKTEAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKG
  ISEDSHLESLQDVGQSAAPTFMISPETVTGTGKKCSLPAEEDSVLEKLGERKPCNSQPSELSSETSGIARPEEGR
  PVVSGTGNDITTPPNKELPPSPEKKTKPLATTQPAKTSTSKAKTQPTSLPKQPAPTTIGGLNKKPMSLASGLVPA
  APPKRPAVASARPSILPSKDVKPKPIADAKAPEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRS
  PSTLLPKKPTAIKTEGKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPST
  TPFIDKKPTSAKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVT
  KTAGPIASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPG
  GGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGL
  NGHPTLSGGGDQREAQTLDSQIQETSI

• Structural information:
  • Interpro: IPR027324  IPR001084  
  • Prosite: PS00229 PS51491
  • STRING: ENSP00000353375
• Other Databases: GeneCards:  MAP4  Malacards:  MAP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030424	axon	ISS	cellular component
GO:0000226	microtubule cytoskeleton organization	ISS	biological process
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0031175	neuron projection development	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0015631	tubulin binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005198	structural molecule activity	TAS	molecular function
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0051301	cell division	IMP	biological process
GO:0051294	establishment of spindle orientation	IGI	biological process
GO:0051294	establishment of spindle orientation	IMP	biological process
GO:0007052	mitotic spindle organization	IMP	biological process
GO:0051012	microtubule sliding	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051012	microtubule sliding	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0051294	establishment of spindle orientation	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0007052	mitotic spindle organization	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0005930	axoneme	IDA	cellular component
GO:1902856	negative regulation of non-motile cilium assembly	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq