• Gene id: 4133

Gene Summary

• Gene Symbol: MAP2   Gene   UCSC   Ensembl
• Aliases: MAP-2, MAP2A, MAP2B, MAP2C
• Gene name: microtubule associated protein 2
• Alternate names: microtubule-associated protein 2,
• Gene location: 2q34 (209424046: 209734117)     Exons: 9     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mou
• OMIM: 157130

Protein Summary

• Protein general information: P11137  
  • Name: Microtubule associated protein 2 (MAP 2)
  • Length: 1827  
  • Mass: 199526
• Sequence:

  MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGI
  NGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVTVE
  EDLLTASKMEFHDQQELTPSTAEPSDQKEKESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTEEEKAPLAL
  FGHTLVASLEDMKQKTEPSLVVPGIDLPKEPPTPKEQKDWFIEMPTEAKKDEWGLVAPISPGPLTPMREKDVFDD
  IPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDKKSLQQTSGPATAKDSFKIEEPHEAK
  PDKMAEAPPSEAMTLPKDAHIPVVEEHVMGKVLEEEKEAINQETVQQRDTFTPSGQEPILTEKETELKLEEKTTI
  SDKEAVPKESKPPKPADEEIGIIQTSTEHTFSEQKDQEPTTDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPS
  ALIEKSSIQELFEMRVDDKDKIEGVGAATSAELDMPFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRE
  SVHESIDTMSPMHKNGDKEFQTGKESQPSPPAQEAGYSTLAQSYPSDLPEEPSSPQERMFTIDPKVYGEKRDLHS
  KNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATT
  PALEKAPCFPVESKEEEQIEKVKATGEESTQAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSRLASVSAD
  AEVARRKSVPSETVVEDSRTGLPPVTDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGT
  DDKVRRDLATDLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRLDTVLEKSEEHADSKE
  HAKKTEEAGDEIETFGLGVTYEQALAKDLSIPTDASSEKAEKGLSSVPEIAEVEPSKKVEQGLDFAVQGQLDVKI
  SDFGQMASGLNIDDRRATELKLEATQDMTPSSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQEAV
  DKEESYESSGEHESLTMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQGP
  KEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDLGVSGAREEFVETCPS
  EHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVERRPSPHDEEEFEVEEAAEAQAEPKDGSPEA
  PASPEREEVALSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSIMTEQLETIPKEEKAEKEARRSSLEKH
  RKEKPFKTGRGRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHSPSRKFILKPAIKYTRPTHLS
  CVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARR
  TTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTP
  PKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKI
  ESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSS
  GSINLLESPQLATLAEDVTAALAKQGL

• Structural information:
  • Interpro: IPR030797  IPR027324  IPR013588  IPR001084  
  • Prosite: PS00229 PS51491
  • DIP: 577
  • STRING: ENSP00000353508
• Other Databases: GeneCards:  MAP2  Malacards:  MAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	TAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:1904527	negative regulation of microtubule binding	ISS	biological process
GO:1904527	negative regulation of microtubule binding	ISS	biological process
GO:1902513	regulation of organelle transport along microtubule	ISS	biological process
GO:2000575	negative regulation of microtubule motor activity	ISS	biological process
GO:1990635	proximal dendrite	ISS	cellular component
GO:1990769	proximal neuron projection	ISS	cellular component
GO:1990769	proximal neuron projection	ISS	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0150001	primary dendrite	ISS	cellular component
GO:0150014	apical distal dendrite	ISS	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0097441	basal dendrite	ISS	cellular component
GO:0044304	main axon	ISS	NOT|cellular component
GO:1903744	positive regulation of anterograde synaptic vesicle transport	ISS	biological process
GO:1903827	regulation of cellular protein localization	ISS	biological process
GO:1903827	regulation of cellular protein localization	ISS	biological process
GO:1903827	regulation of cellular protein localization	ISS	biological process
GO:1903827	regulation of cellular protein localization	ISS	biological process
GO:1901953	positive regulation of anterograde dense core granule transport	ISS	biological process
GO:0044294	dendritic growth cone	ISS	cellular component
GO:0044307	dendritic branch	ISS	cellular component
GO:0016358	dendrite development	TAS	biological process
GO:0150002	distal dendrite	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0032839	dendrite cytoplasm	ISS	cellular component
GO:0043194	axon initial segment	ISS	cellular component
GO:0043194	axon initial segment	ISS	cellular component
GO:0043203	axon hillock	ISS	cellular component
GO:0043203	axon hillock	ISS	cellular component
GO:0043203	axon hillock	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0043198	dendritic shaft	ISS	cellular component
GO:1902737	dendritic filopodium	ISS	cellular component
GO:0031115	negative regulation of microtubule polymerization	ISS	biological process
GO:0000226	microtubule cytoskeleton organization	ISS	biological process
GO:0030517	negative regulation of axon extension	ISS	biological process
GO:0030517	negative regulation of axon extension	ISS	biological process
GO:0031113	regulation of microtubule polymerization	TAS	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0031175	neuron projection development	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0048813	dendrite morphogenesis	IEP	biological process
GO:0031175	neuron projection development	IEP	biological process
GO:0021954	central nervous system neuron development	IEP	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0015631	tubulin binding	IEA	molecular function
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0021954	central nervous system neuron development	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005198	structural molecule activity	NAS	molecular function
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0016358	dendrite development	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0034399	nuclear periphery	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0097442	CA3 pyramidal cell dendrite	IEA	cellular component
GO:1903827	regulation of cellular protein localization	IEA	biological process
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043203	axon hillock	IEA	cellular component
GO:1990769	proximal neuron projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0002162	dystroglycan binding	IPI	molecular function

Diseases

Associated diseases	References
Lewy body dementia	PMID:20024519
Huntington's disease	PMID:20092829
Schizophrenia	PMID:20092829
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray