• Gene id: 412

Gene Summary

• Gene Symbol: STS   Gene   UCSC   Ensembl
• Aliases: ARSC, ARSC1, ASC, ES, SSDD, XLI
• Gene name: steroid sulfatase
• Alternate names: steryl-sulfatase, arylsulfatase C, estrone sulfatase, steroid sulfatase (microsomal), isozyme S, steryl-sulfate sulfohydrolase,
• Gene location: Xp22.31 (7147289: 7354640)     Exons: 16     NC_000023.11
• Gene summary(Entrez): This gene encodes a multi-pass membrane protein that is localized to the endoplasmic reticulum. It belongs to the sulfatase family and hydrolyzes several 3-beta-hydroxysteroid sulfates, which serve as metabolic precursors for estrogens, androgens, and cho

SNPs

rs17268974

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.7318929T>A
NC_000023.11   g.7318929T>C
NC_000023.11   g.7318929T>G
NC_000023.10   g.7236970T>A
NC_000023.10   g.7236970T>C
NC_000023.10   g.7236970T>G
NG_021472.2   g.176678T>A
NG_021472.2   g.176678T>C
NG_021472.2   g.176678T>G|SEQ=[T/A/C/G]|GENE=STS

rs5934740

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.7239611G>A
NC_000023.11   g.7239611G>C
NC_000023.10   g.7157652G>A
NC_000023.10   g.7157652G>C
NG_021472.2   g.97360G>A
NG_021472.2   g.97360G>C|SEQ=[G/A/C]|GENE=STS

rs5934842

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.7264242C>A
NC_000023.11   g.7264242C>G
NC_000023.10   g.7182283C>A
NC_000023.10   g.7182283C>G
NG_021472.2   g.121991C>A
NG_021472.2   g.121991C>G|SEQ=[C/A/G]|GENE=STS

rs5934913

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.7294236G>A
NC_000023.10   g.7212277G>A
NG_021472.2   g.151985G>A|SEQ=[G/A]|GENE=STS

rs6639811

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.7297762A>G
NC_000023.10   g.7215803A>G
NG_021472.2   g.155511A>G|SEQ=[A/G]|GENE=STS

rs3923341

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.7300859C>T
NC_000023.10   g.7218900C>T
NG_021472.2   g.158608C>T|SEQ=[C/T]|GENE=STS

rs5934937

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.7323041C>A
NC_000023.11   g.7323041C>G
NC_000023.11   g.7323041C>T
NC_000023.10   g.7241082C>A
NC_000023.10   g.7241082C>G
NC_000023.10   g.7241082C>T
NG_021472.2   g.180790C>A
NG_021472.2   g.180790C>G
NG_021472.2   g.180790C>T|SEQ=[C/A/G/T]|GENE=STS

rs2292596

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.422840C>G
NC_000005.10   g.422840C>T
NC_000005.9   g.422955C>G
NC_000005.9   g.422955C>T
NG_029834.2   g.123665C>G
NG_029834.2   g.123665C>T
NG_029834.1   g.123665C>G
NG_029834.1   g.123665C>T
NM_020731.4   c.565C>G
NM_020731.4   c.565C>T
NM_001242412.1  

rs3788862

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.43658116A>C
NC_000023.11   g.43658116A>G
NC_000023.10   g.43517364A>C
NC_000023.10   g.43517364A>G
NG_008957.2   g.6956A>C
NG_008957.2   g.6956A>G|SEQ=[A/C/G]|GENE=MAOA

Protein Summary

• Protein general information: P08842  
  • Name: Steryl sulfatase (EC 3.1.6.2) (Arylsulfatase C) (ASC) (Estrone sulfatase) (Steroid sulfatase) (Steryl sulfate sulfohydrolase)
  • Length: 583  
  • Mass: 65492
• Sequence:

  MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLAASPLC
  TPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMSCHSKTDFCHH
  PLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALNCLGLLHVPLGVFFSLLFLAAL
  ILTLFLGFLHYFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFA
  GKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGG
  IRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHYCNAYL
  NAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCFGSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYE
  ILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQLCCPSTGLSCQCDREKQDKRLSR

• Structural information:
  • Interpro: IPR017850  IPR024607  IPR000917  
  • Prosite: PS00523 PS00149
  • PDB: 1P49
  • PDBsum: 1P49
  • STRING: ENSP00000217961
• Other Databases: GeneCards:  STS  Malacards:  STS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004065	arylsulfatase activity	IBA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0008484	sulfuric ester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007565	female pregnancy	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008202	steroid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0004773	steryl-sulfatase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006706	steroid catabolic process	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005764	lysosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0008544	epidermis development	TAS	biological process
GO:0043231	intracellular membrane-bounded organelle	TAS	cellular component
GO:0004773	steryl-sulfatase activity	IEA	molecular function
GO:0008484	sulfuric ester hydrolase activity	IDA	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006687	glycosphingolipid metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00140	Steroid hormone biosynthesis

Diseases

Associated diseases	References
X-linked ichthyosis	KEGG:H00134
X-linked ichthyosis	KEGG:H00134
Cryptorchidism	MIK: 32005174
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
32005174	Cryptorchidism	c.287G?>?A; p.W96*	Pakista ni	18 (16 affected individuals including 2 females with XLI)	Male infertility