Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 4118
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol MAL   Gene   UCSC   Ensembl
Aliases MVP17, VIP17
Gene name mal, T cell differentiation protein
Alternate names myelin and lymphocyte protein, T-lymphocyte maturation-associated protein,
Gene location 2q11.1 (95025654: 95053991)     Exons: 4     NC_000002.12
Gene summary(Entrez) The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal trans
OMIM 186940

Protein Summary
Protein general information P21145  

Name: Myelin and lymphocyte protein (T lymphocyte maturation associated protein)

Length: 153  Mass: 16714

Sequence MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYII
GAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRW
KSS
Structural information
Protein Domains
 (18..15-)
(/note="MARVEL-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
Interpro:  IPR013295  IPR008253  
Prosite:   PS51225
MINT:  
STRING:   ENSP00000310880
Other Databases GeneCards:  MAL  Malacards:  MAL

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0019911 structural constituent of
myelin sheath
 IBA molecular function
GO:0042552 myelination
 IBA biological process
GO:0016021 integral component of mem
brane
 IBA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0045121 membrane raft
 IEA cellular component
GO:0042552 myelination
 IEA biological process
GO:0019911 structural constituent of
myelin sheath
 IEA molecular function
GO:0019898 extrinsic component of me
mbrane
 IEA cellular component
GO:1902043 positive regulation of ex
trinsic apoptotic signali
ng pathway via death doma
in receptors
 IEA biological process
GO:0120003 hinge region between urot
helial plaques of apical
plasma membrane
 IEA cellular component
GO:0045121 membrane raft
 IEA cellular component
GO:0042552 myelination
 IEA biological process
GO:0002175 protein localization to p
aranode region of axon
 IEA biological process
GO:0098737 protein insertion into pl
asma membrane
 IEA biological process
GO:0044853 plasma membrane raft
 IEA cellular component
GO:0016324 apical plasma membrane
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0045121 membrane raft
 IDA cellular component
GO:0045121 membrane raft
 IDA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0019911 structural constituent of
myelin sheath
 IDA molecular function
GO:0045176 apical protein localizati
on
 TAS biological process
GO:0042552 myelination
 TAS biological process
GO:0016505 peptidase activator activ
ity involved in apoptotic
process
 NAS molecular function
GO:0008289 lipid binding
 TAS molecular function
GO:0001766 membrane raft polarizatio
n
 TAS biological process
GO:0016324 apical plasma membrane
 TAS cellular component
GO:0042552 myelination
 NAS biological process
GO:0030154 cell differentiation
 TAS biological process
GO:0007417 central nervous system de
velopment
 TAS biological process
GO:0006915 apoptotic process
 NAS biological process

Diseases

Expand All | Collapse All
Associated diseases References
Metachromatic leukodystrophy PMID:15193296
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract