• Gene id: 4113

Gene Summary

• Gene Symbol: MAGEB2   Gene   UCSC   Ensembl
• Aliases: CT3.2, DAM6, MAGE-XP-2
• Gene name: MAGE family member B2
• Alternate names: melanoma-associated antigen B2, DSS/AHC critical interval MAGE superfamily 6, MAGE XP-2 antigen, MAGE-B2 antigen, cancer/testis antigen 3.2, cancer/testis antigen family 3, member 2, melanoma antigen family B, 2, melanoma antigen family B2,
• Gene location: Xp21.2 (30215562: 30220088)     Exons: 18     NC_000023.11
• Gene summary(Entrez): This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen
• OMIM: 300098

Protein Summary

• Protein general information: O15479  
  • Name: Melanoma associated antigen B2 (Cancer/testis antigen 3.2) (CT3.2) (DSS AHC critical interval MAGE superfamily 6) (DAM6) (MAGE XP 2 antigen) (MAGE B2 antigen)
  • Length: 319  
  • Mass: 35277
  • Tissue specificity: Expressed in testis and placenta, and in a significant fraction of tumors of various histologic types.
• Sequence:

  MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAG
  VSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFP
  EILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWE
  FLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTP
  CAFPTHYEEALKDEEKAGV

• Structural information:
  • Protein Domains: (111..31-)
    (/note="MAGE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00127"-)
  • Interpro: IPR037445  IPR021072  IPR041898  IPR041899  IPR002190  
  • Prosite: PS50838
  • STRING: ENSP00000368273
• Other Databases: GeneCards:  MAGEB2  Malacards:  MAGEB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 21412036
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray