• Gene id: 411

Gene Summary

• Gene Symbol: ARSB   Gene   UCSC   Ensembl
• Aliases: ASB, G4S, MPS6
• Gene name: arylsulfatase B
• Alternate names: arylsulfatase B, N-acetylgalactosamine-4-sulfatase,
• Gene location: 5q14.1 (78986086: 78777208)     Exons: 15     NC_000005.10
• Gene summary(Entrez): Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysacchari
• OMIM: 611542

Protein Summary

• Protein general information: P15848  
  • Name: Arylsulfatase B (ASB) (EC 3.1.6.12) (N acetylgalactosamine 4 sulfatase) (G4S)
  • Length: 533  
  • Mass: 59687
• Sequence:

  MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDAL
  AAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGM
  YRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITN
  HPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTD
  NGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFD
  VWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYW
  FPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKA
  TGVWGPWM

• Structural information:
  • Interpro: IPR017850  IPR024607  IPR000917  
  • Prosite: PS00523 PS00149
  • PDB: 1FSU
  • PDBsum: 1FSU
  • STRING: ENSP00000264914
• Other Databases: GeneCards:  ARSB  Malacards:  ARSB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003943	N-acetylgalactosamine-4-sulfatase activity	IDA	molecular function
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0061580	colon epithelial cell migration	IMP	biological process
GO:0010632	regulation of epithelial cell migration	IMP	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0008484	sulfuric ester hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004065	arylsulfatase activity	TAS	molecular function
GO:0007041	lysosomal transport	TAS	biological process
GO:0005764	lysosome	TAS	cellular component
GO:0007040	lysosome organization	TAS	biological process
GO:0003943	N-acetylgalactosamine-4-sulfatase activity	IEA	molecular function
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0030207	chondroitin sulfate catabolic process	TAS	biological process
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0043627	response to estrogen	IEA	biological process
GO:0009268	response to pH	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0007417	central nervous system development	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0051597	response to methylmercury	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0008484	sulfuric ester hydrolase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04142	Lysosome
hsa00531	Glycosaminoglycan degradation

Diseases

Associated diseases	References
Mucopolysaccharidosis	KEGG:H00421
Mucopolysaccharidosis type VI	KEGG:H00131
Mucopolysaccharidosis	KEGG:H00421
Mucopolysaccharidosis type VI	KEGG:H00131
mucopolysaccharidosis VI	PMID:1550123
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq