• Gene id: 4109

Gene Summary

• Gene Symbol: MAGEA10   Gene   UCSC   Ensembl
• Aliases: CT1.10, MAGE10
• Gene name: MAGE family member A10
• Alternate names: melanoma-associated antigen 10, MAGE-10 antigen, cancer/testis antigen 1.10, cancer/testis antigen family 1, member 10, melanoma antigen family A, 10, melanoma antigen family A10,
• Gene location: Xq28 (152138577: 152133309)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of thi
• OMIM: 300343

Protein Summary

• Protein general information: P43363  
  • Name: Melanoma associated antigen 10 (Cancer/testis antigen 1.10) (CT1.10) (MAGE 10 antigen)
  • Length: 369  
  • Mass: 40780
  • Tissue specificity: Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for spermatogonia, spermatocytes and placenta. {ECO
• Sequence:

  MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVS
  ADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQ
  MKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTG
  ILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP
  RAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE

• Structural information:
  • Protein Domains: (134..33-)
    (/note="MAGE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00127"-)
  • Interpro: IPR037445  IPR021072  IPR041898  IPR041899  IPR030102   IPR002190  
  • Prosite: PS50838
  • STRING: ENSP00000244096
• Other Databases: GeneCards:  MAGEA10  Malacards:  MAGEA10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881