• Gene id: 409

Gene Summary

• Gene Symbol: ARRB2   Gene   UCSC   Ensembl
• Aliases: ARB2, ARR2, BARR2
• Gene name: arrestin beta 2
• Alternate names: beta-arrestin-2, arrestin 3, non-visual arrestin-3,
• Gene location: 17p13.2 (4710618: 4721499)     Exons: 17     NC_000017.11
• Gene summary(Entrez): Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory si

SNPs

rs12920268

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.79433215G>A
NC_000016.9   g.79467112G>A|SEQ=[G/A]|GENE=MAF

Protein Summary

• Protein general information: P32121  
  • Name: Beta arrestin 2 (Arrestin beta 2) (Non visual arrestin 3)
  • Length: 409  
  • Mass: 46106
• Sequence:

  MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLS
  FRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAF
  CAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNS
  TKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
  LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIE
  FDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC

• Structural information:
  • Interpro: IPR000698  IPR011021  IPR014752  IPR011022  IPR017864   IPR014753  IPR014756  
  • Prosite: PS00295
  • DIP: 40089
  • STRING: ENSP00000403701
• Other Databases: GeneCards:  ARRB2  Malacards:  ARRB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007212	dopamine receptor signaling pathway	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060079	excitatory postsynaptic potential	NAS	biological process
GO:0002031	G protein-coupled receptor internalization	TAS	biological process
GO:0051898	negative regulation of protein kinase B signaling	NAS	biological process
GO:0002031	G protein-coupled receptor internalization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0031701	angiotensin receptor binding	IBA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0001664	G protein-coupled receptor binding	IBA	molecular function
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0031701	angiotensin receptor binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0002092	positive regulation of receptor internalization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IEA	biological process
GO:0071889	14-3-3 protein binding	IEA	molecular function
GO:0051928	positive regulation of calcium ion transport	IEA	biological process
GO:0051019	mitogen-activated protein kinase binding	IEA	molecular function
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0034392	negative regulation of smooth muscle cell apoptotic process	IEA	biological process
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0031859	platelet activating factor receptor binding	IEA	molecular function
GO:0031826	type 2A serotonin receptor binding	IEA	molecular function
GO:0031762	follicle-stimulating hormone receptor binding	IEA	molecular function
GO:0031692	alpha-1B adrenergic receptor binding	IEA	molecular function
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:2000727	positive regulation of cardiac muscle cell differentiation	IEA	biological process
GO:0043422	protein kinase B binding	IEA	molecular function
GO:0032720	negative regulation of tumor necrosis factor production	IEA	biological process
GO:0032695	negative regulation of interleukin-12 production	IEA	biological process
GO:0032691	negative regulation of interleukin-1 beta production	IEA	biological process
GO:0032226	positive regulation of synaptic transmission, dopaminergic	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IEA	biological process
GO:1990763	arrestin family protein binding	IEA	molecular function
GO:1904037	positive regulation of epithelial cell apoptotic process	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0050965	detection of temperature stimulus involved in sensory perception of pain	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0042699	follicle-stimulating hormone signaling pathway	IEA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IEA	biological process
GO:0031748	D1 dopamine receptor binding	IEA	molecular function
GO:0031702	type 1 angiotensin receptor binding	IEA	molecular function
GO:0031691	alpha-1A adrenergic receptor binding	IEA	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0002092	positive regulation of receptor internalization	IEA	biological process
GO:0002032	desensitization of G protein-coupled receptor signaling pathway by arrestin	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0007628	adult walking behavior	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0060090	molecular adaptor activity	IDA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0060765	regulation of androgen receptor signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0031623	receptor internalization	IDA	biological process
GO:0031398	positive regulation of protein ubiquitination	IGI	biological process
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0002031	G protein-coupled receptor internalization	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0002032	desensitization of G protein-coupled receptor signaling pathway by arrestin	IMP	biological process
GO:0045953	negative regulation of natural killer cell mediated cytotoxicity	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0060326	cell chemotaxis	IMP	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:0002031	G protein-coupled receptor internalization	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04144	Endocytosis
hsa04062	Chemokine signaling pathway
hsa04740	Olfactory transduction
hsa04728	Dopaminergic synapse
hsa04926	Relaxin signaling pathway
hsa05032	Morphine addiction
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04929	GnRH secretion
hsa04340	Hedgehog signaling pathway
P06959	CCKR signaling map

Diseases

Associated diseases	References
Portal hypertension	PMID:24337852
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R