• Gene id: 4082

Gene Summary

• Gene Symbol: MARCKS   Gene   UCSC   Ensembl
• Aliases: 80K-L, MACS, PKCSL, PRKCSL
• Gene name: myristoylated alanine rich protein kinase C substrate
• Alternate names: myristoylated alanine-rich C-kinase substrate, myristoylated alanine-rich protein kinase C substrate (MARCKS, 80K-L), phosphomyristin, protein kinase C substrate, 80 kDa protein, light chain,
• Gene location: 6q21 (113857344: 113863474)     Exons: 2     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with
• OMIM: 604824

SNPs

rs11703684

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.24748945C>G
NC_000022.11   g.24748945C>T
NC_000022.10   g.25144912C>G
NC_000022.10   g.25144912C>T
NM_001008496.3   c.1411G>C
NM_001008496.3   c.1411G>A
NR_045648.1   n.2042G>C
NR_045648.1   n.2042G>A
NR_045649.1   n.1915A>G
NR_045649.1   n.1915A>C
NM_0  

Protein Summary

• Protein general information: P29966  
  • Name: Myristoylated alanine rich C kinase substrate (MARCKS) (Protein kinase C substrate, 80 kDa protein, light chain) (80K L protein) (PKCSL)
  • Length: 332  
  • Mass: 31555
• Sequence:

  MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKEEPAAA
  GSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAEDGATPSPSNET
  PKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGGEAEAPAAEGGKDEAAGGAAAAAAEAGAASGEQAAAPGEEAAAG
  EEGAAGGDPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACEAPSAAGPGAPPEQEAAPAEE
  PAAAAASSACAAPSQEAQPECSPEAPPAEAAE

• Structural information:
  • Interpro: IPR002101  
  • Prosite: PS00826 PS00827
  • STRING: ENSP00000478061
• Other Databases: GeneCards:  MARCKS  Malacards:  MARCKS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005516	calmodulin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0051015	actin filament binding	TAS	molecular function
GO:0005516	calmodulin binding	TAS	molecular function
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0051015	actin filament binding	IEA	molecular function
GO:0005938	cell cortex	IEA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005080	protein kinase C binding	IEA	molecular function
GO:0051764	actin crosslink formation	IEA	biological process
GO:0051017	actin filament bundle assembly	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0042585	germinal vesicle	IEA	cellular component
GO:0032432	actin filament bundle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa04666	Fc gamma R-mediated phagocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R