• Gene id: 4077

Gene Summary

• Gene Symbol: NBR1   Gene   UCSC   Ensembl
• Aliases: 1A1-3B, IAI3B, M17S2, MIG19
• Gene name: NBR1 autophagy cargo receptor
• Alternate names: next to BRCA1 gene 1 protein, B-box protein, cell migration-inducing gene 19 protein, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125), migration-inducing protein 19, neighbor of BRCA1 gene 1,
• Gene location: 17q21.31 (43170309: 43211687)     Exons: 24     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled-coil motif, which is present in many genes with transformation potential. It functions as a spe
• OMIM: 166945

Protein Summary

• Protein general information: Q14596  
  • Name: Next to BRCA1 gene 1 protein (Cell migration inducing gene 19 protein) (Membrane component chromosome 17 surface marker 2) (Neighbor of BRCA1 gene 1 protein) (Protein 1A1 3B)
  • Length: 966  
  • Mass: 107413
• Sequence:

  MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQG
  NQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKP
  PDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIV
  GVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKA
  EKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLSAAF
  VDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPA
  LEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTE
  QTEGTAACIPQKAKNVASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIE
  KPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQ
  MTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSM
  YSSALSQPGLERGAEGKPGVEAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSS
  PCVHHHGSPGVDLPVTIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKAL
  FAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY

• Structural information:
  • Protein Domains: (4..8-)
    (/note="PB1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01081-)
    (913..95-)
    (/note="UBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212"-)
  • Interpro: IPR013783  IPR032350  IPR033513  IPR000270  IPR034852   IPR015940  IPR009060  IPR000433  
  • Prosite: PS51745 PS50030 PS01357 PS50135
  • CDD: cd14947 cd06396
  • PDB: 1WJ6 2BKF 2CP8 2G4S 2L8J 2MGW 2MJ5 4OLE
  • PDBsum: 1WJ6 2BKF 2CP8 2G4S 2L8J 2MGW 2MJ5 4OLE
  • STRING: ENSP00000411250
• Other Databases: GeneCards:  NBR1  Malacards:  NBR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IDA	colocalizes with
GO:0016236	macroautophagy	IBA	biological process
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0000407	phagophore assembly site	IBA	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000407	phagophore assembly site	IEA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016236	macroautophagy	IEA	biological process
GO:0043130	ubiquitin binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0030500	regulation of bone mineralization	IEA	biological process
GO:0005776	autophagosome	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0051019	mitogen-activated protein kinase binding	IEA	molecular function
GO:0032872	regulation of stress-activated MAPK cascade	IEA	biological process
GO:0000407	phagophore assembly site	IEA	cellular component
GO:0051019	mitogen-activated protein kinase binding	ISS	molecular function
GO:0032872	regulation of stress-activated MAPK cascade	ISS	biological process
GO:0005776	autophagosome	ISS	colocalizes with
GO:0030500	regulation of bone mineralization	ISS	biological process
GO:0045668	negative regulation of osteoblast differentiation	ISS	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0031430	M band	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0016236	macroautophagy	IDA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray