• Gene id: 4076

Gene Summary

• Gene Symbol: CAPRIN1   Gene   UCSC   Ensembl
• Aliases: GPIAP1, GPIP137, GRIP137, M11S1, RNG105, p137GPI
• Gene name: cell cycle associated protein 1
• Alternate names: caprin-1, GPI-anchored membrane protein 1, GPI-anchored protein p137, GPI-p137, RNA granule protein 105, activation/proliferation-associated protein 1, caprin 1, cytoplasmic activation- and proliferation-associated protein 1, cytoplasmic activation/proliferation-,
• Gene location: 11p13 (77435033: 77282127)     Exons: 23     NC_000016.10
• OMIM: 601178

Protein Summary

• Protein general information: Q14444  
  • Name: Caprin 1 (Cell cycle associated protein 1) (Cytoplasmic activation and proliferation associated protein 1) (GPI anchored membrane protein 1) (GPI anchored protein p137) (GPI p137) (p137GPI) (Membrane component chromosome 11 surface marker 1) (RNA granule
  • Length: 709  
  • Mass: 78366
  • Tissue specificity: Ubiquitous.
• Sequence:

  MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKL
  DDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVL
  ELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV
  CGTTYKVLKEIVERVFQSNYFDSTHNHQNGLCEEEEAASAPAVEDQVPEAEPEPAEEYTEQSEVESTEYVNRQFM
  AETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQADPLVRRQRVQDLMAQMQGPYNFIQD
  SMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQPNQVPVQPEATQVPLVSSTSEGYTASQPLYQ
  PSHATEQRPQKEPIDQIQATISLNTDQTTASSSLPAASQPQVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAP
  VPPVNEPETLKQQNQYQASYNQSFSSQPHQVEQTELQQEQLQTVVGTYHGSPDQSHQVTGNHQQPPQQNTGFPRS
  NQPYYNSRGVSRGGSRGARGLMNGYRGPANGFRGGYDGYRPSFSNTPNSGYTQSQFSAPRDYSGYQRDGYQQNFK
  RGSGQSGPRGAPRGRGGPPRPNRGMPQMNTQQVN

• Structural information:
  • Interpro: IPR028816  IPR022070  IPR041637  
  • PDB: 4WBE 4WBP
  • PDBsum: 4WBE 4WBP
  • STRING: ENSP00000340329
• Other Databases: GeneCards:  CAPRIN1  Malacards:  CAPRIN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0031252	cell leading edge	IDA	cellular component
GO:0061003	positive regulation of dendritic spine morphogenesis	ISS	biological process
GO:0050775	positive regulation of dendrite morphogenesis	ISS	biological process
GO:0017148	negative regulation of translation	ISS	biological process
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0000932	P-body	ISS	cellular component
GO:0003723	RNA binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017148	negative regulation of translation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0061003	positive regulation of dendritic spine morphogenesis	IEA	biological process
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray