• Gene id: 4074

Gene Summary

• Gene Symbol: M6PR   Gene   UCSC   Ensembl
• Aliases: CD-M6PR, CD-MPR, MPR 46, MPR-46, MPR46, SMPR
• Gene name: mannose-6-phosphate receptor, cation dependent
• Alternate names: cation-dependent mannose-6-phosphate receptor, 46-kDa mannose 6-phosphate receptor, CD Man-6-P receptor, Mr 46,000 Man6PR, small mannose 6-phosphate receptor,
• Gene location: 12p13.31 (8949760: 8940360)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein func
• OMIM: 154540

Protein Summary

• Protein general information: P20645  
  • Name: Cation dependent mannose 6 phosphate receptor (CD Man 6 P receptor) (CD MPR) (46 kDa mannose 6 phosphate receptor) (MPR 46)
  • Length: 277  
  • Mass: 30993
• Sequence:

  MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDTYIYIF
  RVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTL
  ADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPH
  LAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM

• Structural information:
  • Interpro: IPR028927  IPR000296  IPR009011  
  • PDB: 1JUQ
  • PDBsum: 1JUQ
  • STRING: ENSP00000000412
• Other Databases: GeneCards:  M6PR  Malacards:  M6PR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1905394	retromer complex binding	IMP	molecular function
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0006622	protein targeting to lysosome	IBA	biological process
GO:0007041	lysosomal transport	ISS	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006622	protein targeting to lysosome	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0008333	endosome to lysosome transport	TAS	biological process
GO:0005768	endosome	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005770	late endosome	IEA	cellular component
GO:0007041	lysosomal transport	IEA	biological process
GO:0033299	secretion of lysosomal enzymes	IEA	biological process
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04145	Phagosome
hsa04142	Lysosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881