• Gene id: 4070

Gene Summary

• Gene Symbol: TACSTD2   Gene   UCSC   Ensembl
• Aliases: EGP-1, EGP1, GA733-1, GA7331, GP50, M1S1, TROP2
• Gene name: tumor associated calcium signal transducer 2
• Alternate names: tumor-associated calcium signal transducer 2, 40kD glycoprotein, identified by monoclonal antibody GA733, cell surface glycoprotein TROP2, cell surface glycoprotein Trop-2, epithelial glycoprotein-1, gastrointestinal tumor-associated antigen GA7331, membrane co,
• Gene location: 1p32.1 (58577251: 58575432)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009]
• OMIM: 137290

SNPs

rs4938723

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.111511840T>C
NC_000011.9   g.111382565T>C|SEQ=[T/C]|GENE=BTG4
MIR34B   407041
MIR34C   407042
LOC728196   728196

Protein Summary

• Protein general information: P09758  
  • Name: Tumor associated calcium signal transducer 2 (Cell surface glycoprotein Trop 2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733 1)
  • Length: 323  
  • Mass: 35709
  • Tissue specificity: Placenta, pancreatic carcinoma cell lines.
• Sequence:

  MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLL
  LKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVR
  THHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYY
  FERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNR
  RKSGKYKKVEIKELGELRKEPSL

• Structural information:
  • Protein Domains: (70..14-)
    (/note="Thyroglobulin-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00500"-)
  • Interpro: IPR000716  IPR036857  
  • Prosite: PS00484 PS51162
  • CDD: cd00191
  • PDB: 2MAE 2MVK 2MVL
  • PDBsum: 2MAE 2MVK 2MVL
  • STRING: ENSP00000360269
• Other Databases: GeneCards:  TACSTD2  Malacards:  TACSTD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:2000738	positive regulation of stem cell differentiation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007601	visual perception	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007601	visual perception	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000738	positive regulation of stem cell differentiation	IEA	biological process
GO:1900028	negative regulation of ruffle assembly	IEA	biological process
GO:0090191	negative regulation of branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0060675	ureteric bud morphogenesis	IEA	biological process
GO:0051497	negative regulation of stress fiber assembly	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0010633	negative regulation of epithelial cell migration	IEA	biological process
GO:0009925	basal plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:2000146	negative regulation of cell motility	IEA	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IEA	biological process
GO:0050678	regulation of epithelial cell proliferation	IEA	biological process
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	ISS	biological process
GO:1900028	negative regulation of ruffle assembly	ISS	biological process
GO:0009925	basal plasma membrane	ISS	cellular component
GO:2000146	negative regulation of cell motility	ISS	biological process
GO:0016328	lateral plasma membrane	ISS	cellular component
GO:0090191	negative regulation of branching involved in ureteric bud morphogenesis	ISS	biological process
GO:0051497	negative regulation of stress fiber assembly	ISS	biological process
GO:0010633	negative regulation of epithelial cell migration	ISS	biological process

Diseases

Associated diseases	References
Gelatinous drop-like corneal dystrophy	KEGG:H00953
Gelatinous drop-like corneal dystrophy	KEGG:H00953
Corneal dystrophy	PMID:10192395
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881