• Gene id: 4067

Gene Summary

• Gene Symbol: LYN   Gene   UCSC   Ensembl
• Aliases: JTK8, p53Lyn, p56Lyn
• Gene name: LYN proto-oncogene, Src family tyrosine kinase
• Alternate names: tyrosine-protein kinase Lyn, lck/Yes-related novel protein tyrosine kinase, v-yes-1 Yamaguchi sarcoma viral related oncogene homolog,
• Gene location: 8q12.1 (55876040: 56014168)     Exons: 15     NC_000008.11
• Gene summary(Entrez): This gene encodes a tyrosine protein kinase, which maybe involved in the regulation of mast cell degranulation, and erythroid differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided b
• OMIM: 165120

Protein Summary

• Protein general information: P07948  
  • Name: Tyrosine protein kinase Lyn (EC 2.7.10.2) (Lck/Yes related novel protein tyrosine kinase) (V yes 1 Yamaguchi sarcoma viral related oncogene homolog) (p53Lyn) (p56Lyn)
  • Length: 512  
  • Mass: 58574
  • Tissue specificity: Detected in monocytes (at protein level). Detected in placenta, and in fetal brain, lung, liver and kidney. Widely expressed in a variety of organs, tissues, and cell types such as epidermoid, hematopoietic, and neuronal cells. Express
• Sequence:

  MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYD
  GIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSA
  GAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKA
  CISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
  KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLV
  SESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNA
  DVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP

• Structural information:
  • Protein Domains: (63..12-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (129..22-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (247..50-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR035852  IPR035748  IPR000719  IPR017441   IPR001245  IPR000980  IPR036860  IPR036028  IPR001452  IPR008266  IPR020635  
  • Prosite: PS00107 PS50011 PS00109 PS50001 PS50002
  • CDD: cd10364 cd12004
  • PDB: 1W1F 1WA7 3A4O 5XY1 6NMW
  • PDBsum: 1W1F 1WA7 3A4O 5XY1 6NMW
  • DIP: 1056
  • STRING: ENSP00000428924
• Other Databases: GeneCards:  LYN  Malacards:  LYN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016301	kinase activity	NAS	molecular function
GO:0046875	ephrin receptor binding	IPI	molecular function
GO:1902961	positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process	IMP	biological process
GO:0045121	membrane raft	ISS	cellular component
GO:0001934	positive regulation of protein phosphorylation	IGI	biological process
GO:0002902	regulation of B cell apoptotic process	IBA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0030889	negative regulation of B cell proliferation	IBA	biological process
GO:0031175	neuron projection development	IBA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0050855	regulation of B cell receptor signaling pathway	IBA	biological process
GO:0002431	Fc receptor mediated stimulatory signaling pathway	IBA	biological process
GO:0002513	tolerance induction to self antigen	IBA	biological process
GO:0002576	platelet degranulation	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0043304	regulation of mast cell degranulation	IBA	biological process
GO:0070667	negative regulation of mast cell proliferation	IBA	biological process
GO:0090330	regulation of platelet aggregation	IBA	biological process
GO:0097028	dendritic cell differentiation	IBA	biological process
GO:2000670	positive regulation of dendritic cell apoptotic process	IBA	biological process
GO:0051272	positive regulation of cellular component movement	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0070304	positive regulation of stress-activated protein kinase signaling cascade	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1902532	negative regulation of intracellular signal transduction	ISS	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0050855	regulation of B cell receptor signaling pathway	ISS	biological process
GO:0033003	regulation of mast cell activation	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0002774	Fc receptor mediated inhibitory signaling pathway	ISS	biological process
GO:0002768	immune response-regulating cell surface receptor signaling pathway	TAS	biological process
GO:0002768	immune response-regulating cell surface receptor signaling pathway	ISS	biological process
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0001817	regulation of cytokine production	ISS	biological process
GO:2000670	positive regulation of dendritic cell apoptotic process	ISS	biological process
GO:0097028	dendritic cell differentiation	ISS	biological process
GO:0090330	regulation of platelet aggregation	ISS	biological process
GO:0090025	regulation of monocyte chemotaxis	IMP	biological process
GO:0070668	positive regulation of mast cell proliferation	IMP	biological process
GO:0070667	negative regulation of mast cell proliferation	ISS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0050777	negative regulation of immune response	TAS	biological process
GO:0045646	regulation of erythrocyte differentiation	ISS	biological process
GO:0043407	negative regulation of MAP kinase activity	ISS	biological process
GO:0043304	regulation of mast cell degranulation	ISS	biological process
GO:0034144	negative regulation of toll-like receptor 4 signaling pathway	ISS	biological process
GO:0034136	negative regulation of toll-like receptor 2 signaling pathway	ISS	biological process
GO:0033628	regulation of cell adhesion mediated by integrin	IMP	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	ISS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002576	platelet degranulation	ISS	biological process
GO:0002513	tolerance induction to self antigen	TAS	biological process
GO:0002513	tolerance induction to self antigen	ISS	biological process
GO:0002431	Fc receptor mediated stimulatory signaling pathway	ISS	biological process
GO:0001932	regulation of protein phosphorylation	TAS	biological process
GO:0001782	B cell homeostasis	ISS	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0002250	adaptive immune response	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0046579	positive regulation of Ras protein signal transduction	TAS	biological process
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0033003	regulation of mast cell activation	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0030889	negative regulation of B cell proliferation	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0002902	regulation of B cell apoptotic process	IEA	biological process
GO:0002774	Fc receptor mediated inhibitory signaling pathway	IEA	biological process
GO:0002768	immune response-regulating cell surface receptor signaling pathway	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0001817	regulation of cytokine production	IEA	biological process
GO:1902532	negative regulation of intracellular signal transduction	IEA	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0050855	regulation of B cell receptor signaling pathway	IEA	biological process
GO:0050853	B cell receptor signaling pathway	IEA	biological process
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0070447	positive regulation of oligodendrocyte progenitor proliferation	IEA	biological process
GO:0060369	positive regulation of Fc receptor mediated stimulatory signaling pathway	IEA	biological process
GO:0060252	positive regulation of glial cell proliferation	IEA	biological process
GO:0051219	phosphoprotein binding	IEA	molecular function
GO:0048678	response to axon injury	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0043208	glycosphingolipid binding	IEA	molecular function
GO:0034605	cellular response to heat	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0031668	cellular response to extracellular stimulus	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0009743	response to carbohydrate	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0006991	response to sterol depletion	IEA	biological process
GO:0005161	platelet-derived growth factor receptor binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0045646	regulation of erythrocyte differentiation	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0043304	regulation of mast cell degranulation	IEA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0034144	negative regulation of toll-like receptor 4 signaling pathway	IEA	biological process
GO:0034142	toll-like receptor 4 signaling pathway	IEA	biological process
GO:0034136	negative regulation of toll-like receptor 2 signaling pathway	IEA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0030097	hemopoiesis	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0002762	negative regulation of myeloid leukocyte differentiation	IEA	biological process
GO:0002576	platelet degranulation	IEA	biological process
GO:0002513	tolerance induction to self antigen	IEA	biological process
GO:0002431	Fc receptor mediated stimulatory signaling pathway	IEA	biological process
GO:0001782	B cell homeostasis	IEA	biological process
GO:2000670	positive regulation of dendritic cell apoptotic process	IEA	biological process
GO:0097028	dendritic cell differentiation	IEA	biological process
GO:0090330	regulation of platelet aggregation	IEA	biological process
GO:0070667	negative regulation of mast cell proliferation	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0051279	regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0099091	postsynaptic specialization, intracellular component	IEA	cellular component
GO:0051279	regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0050663	cytokine secretion	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043434	response to peptide hormone	IEA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043015	gamma-tubulin binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0042327	positive regulation of phosphorylation	IEA	biological process
GO:0034666	integrin alpha2-beta1 complex	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0030061	mitochondrial crista	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005178	integrin binding	IEA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0002553	histamine secretion by mast cell	IEA	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010976	positive regulation of neuron projection development	IMP	biological process
GO:0071300	cellular response to retinoic acid	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0042629	mast cell granule	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0030218	erythrocyte differentiation	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	ISS	biological process
GO:0009725	response to hormone	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0140031	phosphorylation-dependent protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04062	Chemokine signaling pathway
hsa05130	Pathogenic Escherichia coli infection
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04611	Platelet activation
hsa04064	NF-kappa B signaling pathway
hsa04666	Fc gamma R-mediated phagocytosis
hsa04662	B cell receptor signaling pathway
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa04664	Fc epsilon RI signaling pathway
hsa04730	Long-term depression
P06959	CCKR signaling map

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R