• Gene id: 4063

Gene Summary

• Gene Symbol: LY9   Gene   UCSC   Ensembl
• Aliases: CD229, SLAMF3, hly9, mLY9
• Gene name: lymphocyte antigen 9
• Alternate names: T-lymphocyte surface antigen Ly-9, SLAM family member 3, cell surface molecule Ly-9, signaling lymphocytic activation molecule 3,
• Gene location: 1q23.3 (160796111: 160828255)     Exons: 12     NC_000001.11
• Gene summary(Entrez): LY9 belongs to the SLAM family of immunomodulatory receptors (see SLAMF1; MIM 603492) and interacts with the adaptor molecule SAP (SH2D1A; MIM 300490) (Graham et al., 2006 [PubMed 16365421]).[supplied by OMIM, Mar 2008]
• OMIM: 603216

Protein Summary

• Protein general information: Q9HBG7  
  • Name: T lymphocyte surface antigen Ly 9 (Cell surface molecule Ly 9) (Lymphocyte antigen 9) (SLAM family member 3) (SLAMF3) (Signaling lymphocytic activation molecule 3) (CD antigen CD229)
  • Length: 655  
  • Mass: 72139
  • Tissue specificity: Increased surface expression on T-cells of systemic lupus erythematosus (SLE) patients. {ECO
• Sequence:

  MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILGGSVTLPLNISVDTEI
  ENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNLTLNDAGSYKAQINQRNFEVTTEEEFTLFV
  YEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVSRTPCDPDLPYICTAQ
  NPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKVVWLFNTSIISKEREEAATAD
  PLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMTHVTLLIYRRLRKPKITWSLRHSEDG
  ICRISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWRSSENHPNLTCTASNPVSRSSHQFLSENICSGPE
  RNTKLWIGLFLMVCLLCVGIFSWCIWKRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPA
  RQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYEVFDQVTQEGAGHDPAPEGQADYDPVTPYVTEVESVVGEN
  TMYAQVFNLQGKTPVSQKEESSATIYCSIRKPQVVPPPQQNDLEIPESPTYENFT

• Structural information:
  • Protein Domains: (48..15-)
    1 (/note="Ig-like-V-type)
    (159..23-)
    1 (/note="Ig-like-C2-type)
    (251..36-)
    2 (/note="Ig-like-V-type)
    (364..45-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  
  • Prosite: PS50835
  • STRING: ENSP00000263285
• Other Databases: GeneCards:  LY9  Malacards:  LY9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0072540	T-helper 17 cell lineage commitment	IDA	biological process
GO:0032740	positive regulation of interleukin-17 production	IDA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray