• Gene id: 4062

Gene Summary

• Gene Symbol: LY6H   Gene   UCSC   Ensembl
• Aliases: NMLY6
• Gene name: lymphocyte antigen 6 family member H
• Alternate names: lymphocyte antigen 6H, ly-6H, lymphocyte antigen 6 complex, locus H,
• Gene location: 8q24.3 (143160653: 143157915)     Exons: 6     NC_000008.11
• OMIM: 612143

Protein Summary

• Protein general information: O94772  
  • Name: Lymphocyte antigen 6H (Ly 6H)
  • Length: 140  
  • Mass: 14669
  • Tissue specificity: Highly expressed in brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. Also found in lower levels in testis, pancreas, small intestine and colon.
• Sequence:

  MLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCAS
  SCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP

• Structural information:
  • Protein Domains: (26..9-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR016054  
  • STRING: ENSP00000399485
• Other Databases: GeneCards:  LY6H  Malacards:  LY6H

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033130	acetylcholine receptor binding	IBA	molecular function
GO:0095500	acetylcholine receptor signaling pathway	IBA	biological process
GO:0030550	acetylcholine receptor inhibitor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq