• Gene id: 4061

Gene Summary

• Gene Symbol: LY6E   Gene   UCSC   Ensembl
• Aliases: RIG-E, RIGE, SCA-2, SCA2, TSA-1
• Gene name: lymphocyte antigen 6 family member E
• Alternate names: lymphocyte antigen 6E, ly-6E, lymphocyte antigen 6 complex, locus E, retinoic acid induced gene E, retinoic acid-induced gene E protein, stem cell antigen 2, thymic shared antigen 1,
• Gene location: 8q24.3 (143018484: 143022409)     Exons: 19     NC_000008.11
• OMIM: 601384

Protein Summary

• Protein general information: Q16553  
  • Name: Lymphocyte antigen 6E (Ly 6E) (Retinoic acid induced gene E protein) (RIG E) (Stem cell antigen 2) (SCA 2) (Thymic shared antigen 1) (TSA 1)
  • Length: 131  
  • Mass: 13507
  • Tissue specificity: Widely expressed, predominantly in liver, kidney, ovary, spleen and peripheral blood Leukocytes.
• Sequence:

  MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPAC
  PIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP

• Structural information:
  • Protein Domains: (21..10-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR016054  
  • STRING: ENSP00000428572
• Other Databases: GeneCards:  LY6E  Malacards:  LY6E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031225	anchored component of membrane	IBA	cellular component
GO:0030550	acetylcholine receptor inhibitor activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R