• Gene id: 4057

Gene Summary

• Gene Symbol: LTF   Gene   UCSC   Ensembl
• Aliases: GIG12, HEL110, HLF2, LF
• Gene name: lactotransferrin
• Alternate names: lactotransferrin, epididymis luminal protein 110, growth-inhibiting protein 12, kaliocin-1, lactoferricin, lactoferroxin, neutrophil lactoferrin, talalactoferrin,
• Gene location: 3p21.31 (46485233: 46436004)     Exons: 22     NC_000003.12
• Gene summary(Entrez): This gene is a member of the transferrin family of genes and its protein product is found in the secondary granules of neutrophils. The protein is a major iron-binding protein in milk and body secretions with an antimicrobial activity, making it an import
• OMIM: 150210

Protein Summary

• Protein general information: P02788  
  • Name: Lactotransferrin (Lactoferrin) (EC 3.4.21. ) (Growth inhibiting protein 12) (Talalactoferrin) [Cleaved into: Lactoferricin H (Lfcin H); Kaliocin 1; Lactoferroxin A; Lactoferroxin B; Lactoferroxin C]
  • Length: 710  
  • Mass: 78,182
• Sequence:

  MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADA
  VTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGT
  LRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDV
  AFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD
  KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELR
  KCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRP
  VEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCAL
  CIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK
  PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK
  TTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK

• Structural information:
  • Protein Domains: Transferrin-like (25-352)
    Transferrin-like (364-695)
  • Interpro: IPR030684  IPR016357  IPR001156  IPR018195  
  • Prosite: PS00205 PS00206 PS00207 PS51408
  • PDB: 1B0L 1BKA 1CB6 1DSN 1EH3 1FCK 1H43 1H44 1H45 1HSE 1L5T 1LCF 1LCT 1LFG 1LFH 1LFI 1LGB 1N76 1SQY 1U62 1VFD 1VFE 1XV4 1XV7 1Z6V 1Z6W 2BJJ 2DP4 2GMC 2GMD 2HD4 2PMS
  • PDBsum: 1B0L 1BKA 1CB6 1DSN 1EH3 1FCK 1H43 1H44 1H45 1HSE 1L5T 1LCF 1LCT 1LFG 1LFH 1LFI 1LGB 1N76 1SQY 1U62 1VFD 1VFE 1XV4 1XV7 1Z6V 1Z6W 2BJJ 2DP4 2GMC 2GMD 2HD4 2PMS
  • DIP: 41354
  • STRING: ENSP00000231751
• Other Databases: GeneCards:  LTF  Malacards:  LTF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001503	ossification	IEA	biological process
GO:0001817	regulation of cytokine production	IDA	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0002227	innate immune response in mucosa	IDA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0005506	iron ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IMP	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006959	humoral immune response	TAS	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0030141	secretory granule	IDA	cellular component
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032680	regulation of tumor necrosis factor production	IDA	biological process
GO:0032780	negative regulation of ATPase activity	IMP	biological process
GO:0033214	iron assimilation by chelation and transport	TAS	biological process
GO:0033690	positive regulation of osteoblast proliferation	IDA	biological process
GO:0034145	positive regulation of toll-like receptor 4 signaling pathway	IMP	biological process
GO:0042581	specific granule	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0044793	negative regulation by host of viral process	IMP	biological process
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0045454	cell redox homeostasis	TAS	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0048525	negative regulation of viral process	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0060349	bone morphogenesis	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:1900159	positive regulation of bone mineralization involved in bone maturation	ISS	biological process
GO:1900229	negative regulation of single-species biofilm formation in or on host organism	IDA	biological process
GO:1902732	positive regulation of chondrocyte proliferation	IDA	biological process
GO:2000308	negative regulation of tumor necrosis factor (ligand) superfamily member 11 production	ISS	biological process
GO:2001205	negative regulation of osteoclast development	ISS	biological process
GO:0001503	ossification	IEA	biological process
GO:0001817	regulation of cytokine production	IEA	biological process
GO:0001817	regulation of cytokine production	IDA	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0002227	innate immune response in mucosa	IDA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0005506	iron ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IMP	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006810	transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006959	humoral immune response	TAS	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0019731	antibacterial humoral response	IEA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IEA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0030141	secretory granule	IDA	cellular component
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032680	regulation of tumor necrosis factor production	IDA	biological process
GO:0032780	negative regulation of ATPase activity	IMP	biological process
GO:0033214	iron assimilation by chelation and transport	TAS	biological process
GO:0033690	positive regulation of osteoblast proliferation	IDA	biological process
GO:0034145	positive regulation of toll-like receptor 4 signaling pathway	IMP	biological process
GO:0042581	specific granule	IDA	cellular component
GO:0042742	defense response to bacterium	IEA	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0044793	negative regulation by host of viral process	IMP	biological process
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0045454	cell redox homeostasis	TAS	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048525	negative regulation of viral process	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0060349	bone morphogenesis	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:1900159	positive regulation of bone mineralization involved in bone maturation	ISS	biological process
GO:1900229	negative regulation of single-species biofilm formation in or on host organism	IDA	biological process
GO:1902732	positive regulation of chondrocyte proliferation	IDA	biological process
GO:2000308	negative regulation of tumor necrosis factor (ligand) superfamily member 11 production	ISS	biological process
GO:2001205	negative regulation of osteoclast development	ISS	biological process
GO:0001817	regulation of cytokine production	IDA	biological process
GO:0001895	retina homeostasis	IEP	biological process
GO:0002227	innate immune response in mucosa	IDA	biological process
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005506	iron ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IMP	cellular component
GO:0006959	humoral immune response	TAS	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0030141	secretory granule	IDA	cellular component
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032680	regulation of tumor necrosis factor production	IDA	biological process
GO:0032780	negative regulation of ATPase activity	IMP	biological process
GO:0033214	iron assimilation by chelation and transport	TAS	biological process
GO:0033690	positive regulation of osteoblast proliferation	IDA	biological process
GO:0034145	positive regulation of toll-like receptor 4 signaling pathway	IMP	biological process
GO:0042581	specific granule	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0044793	negative regulation by host of viral process	IMP	biological process
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0045454	cell redox homeostasis	TAS	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0048525	negative regulation of viral process	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0060349	bone morphogenesis	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:0097013	phagocytic vesicle lumen	TAS	cellular component
GO:1900159	positive regulation of bone mineralization involved in bone maturation	ISS	biological process
GO:1900229	negative regulation of single-species biofilm formation in or on host organism	IDA	biological process
GO:1902732	positive regulation of chondrocyte proliferation	IDA	biological process
GO:2000308	negative regulation of tumor necrosis factor (ligand) superfamily member 11 production	ISS	biological process
GO:2001205	negative regulation of osteoclast development	ISS	biological process

Diseases

Associated diseases	References
Aggressive periodontitis	GAD: 18973542
Dyslipidemias	GAD: 18156281
Abortion	GAD: 20587610
Chorioamnionitis	GAD: 20452482
Endometriosis	INFBASE: 16644090
Endometriosis	INFBASE: 17611835
Female infertility	INFBASE: 17611835
Fertilizing defects	INFBASE: 17094987
Azoospermia	MIK: 22182811
Oligozoospermia	MIK: 22182811
Male factor infertility	MIK: 23455884
Asthenozoospermia	MIK: 23455884
Nephropathy	GAD: 11748357
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 22182811
Oligospermia	MIK: 22182811
Cryptorchidism	MIK: 28606200
Asthenozoospermia	MIK: 23455884
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23455884	Idiopathic asthenozoospermia				Male infertility	GRP78 lactoferrin SPANXB PGK2 flagellin DJ-1 XPA binding protein 2 CAB2 GPX4 and GAPDH
22182811	Azoospermia, Oligospermia				Male infertility	Lactoferrin Prostatic acid phosphatase Human Zinc-Alpha-2-Glycoprotein Prostate specific antigen Progestagen-associated endometrial protein Kinesin light chain 4 Kinesin light chain 4 Prolactin inducible protein Izumo sperm-egg fusion protein 1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq