• Gene id: 4056

Gene Summary

• Gene Symbol: LTC4S   Gene   UCSC   Ensembl
• Gene name: leukotriene C4 synthase
• Alternate names: leukotriene C4 synthase, LTC4 synthase,
• Gene location: 5q35.3 (179793985: 179796646)     Exons: 5     NC_000005.10
• Gene summary(Entrez): The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the bi
• OMIM: 608436

Protein Summary

• Protein general information: Q16873  
  • Name: Leukotriene C4 synthase (LTC4 synthase) (EC 4.4.1.20) (Leukotriene C(4) synthase)
  • Length: 150  
  • Mass: 16567
  • Tissue specificity: Detected in lung, platelets and the myelogenous leukemia cell line KG-1 (at protein level). LTC4S activity is present in eosinophils, basophils, mast cells, certain phagocytic mononuclear cells, endothelial cells, vascular smooth muscl
• Sequence:

  MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFH
  EGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

• Structural information:
  • Interpro: IPR001446  IPR018295  IPR023352  IPR001129  
  • Prosite: PS01297
  • PDB: 2PNO 2UUH 2UUI 3B29 3HKK 3LEO 3PCV 4BPM 4J7T 4J7Y 4JC7 4JCZ 4JRZ 4WAB 5HV9 6R7D
  • PDBsum: 2PNO 2UUH 2UUI 3B29 3HKK 3LEO 3PCV 4BPM 4J7T 4J7Y 4JC7 4JCZ 4JRZ 4WAB 5HV9 6R7D
  • DIP: 48473
  • STRING: ENSP00000292596
• Other Databases: GeneCards:  LTC4S  Malacards:  LTC4S

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0004464	leukotriene-C4 synthase activity	IBA	molecular function
GO:0019370	leukotriene biosynthetic process	IBA	biological process
GO:0005635	nuclear envelope	IBA	cellular component
GO:0004602	glutathione peroxidase activity	IBA	molecular function
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0042759	long-chain fatty acid biosynthetic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0004464	leukotriene-C4 synthase activity	IDA	molecular function
GO:0006691	leukotriene metabolic process	IDA	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005640	nuclear outer membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006691	leukotriene metabolic process	IEA	biological process
GO:0008047	enzyme activator activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019370	leukotriene biosynthetic process	IEA	biological process
GO:0004464	leukotriene-C4 synthase activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0043231	intracellular membrane-bounded organelle	TAS	cellular component
GO:0004464	leukotriene-C4 synthase activity	IEA	molecular function
GO:0008289	lipid binding	IDA	molecular function
GO:0006691	leukotriene metabolic process	IDA	biological process
GO:0004464	leukotriene-C4 synthase activity	IDA	molecular function
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:2001301	lipoxin biosynthetic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004464	leukotriene-C4 synthase activity	IEA	molecular function
GO:0006691	leukotriene metabolic process	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005640	nuclear outer membrane	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0004464	leukotriene-C4 synthase activity	IBA	molecular function
GO:0019370	leukotriene biosynthetic process	IBA	biological process
GO:0005635	nuclear envelope	IBA	cellular component
GO:0004602	glutathione peroxidase activity	IBA	molecular function
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0042759	long-chain fatty acid biosynthetic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0004464	leukotriene-C4 synthase activity	IDA	molecular function
GO:0006691	leukotriene metabolic process	IDA	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005640	nuclear outer membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006691	leukotriene metabolic process	IEA	biological process
GO:0008047	enzyme activator activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019370	leukotriene biosynthetic process	IEA	biological process
GO:0004464	leukotriene-C4 synthase activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0043231	intracellular membrane-bounded organelle	TAS	cellular component
GO:0004464	leukotriene-C4 synthase activity	IEA	molecular function
GO:0008289	lipid binding	IDA	molecular function
GO:0006691	leukotriene metabolic process	IDA	biological process
GO:0004464	leukotriene-C4 synthase activity	IDA	molecular function
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:2001301	lipoxin biosynthetic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004464	leukotriene-C4 synthase activity	IEA	molecular function
GO:0006691	leukotriene metabolic process	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005640	nuclear outer membrane	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00590	Arachidonic acid metabolism

Diseases

Associated diseases	References
Leukotriene C4 synthase deficiency	KEGG:H02284
Leukotriene C4 synthase deficiency	KEGG:H02284
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R