• Gene id: 4055

Gene Summary

• Gene Symbol: LTBR   Gene   UCSC   Ensembl
• Aliases: D12S370, LT-BETA-R, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFR3, TNFRSF3
• Gene name: lymphotoxin beta receptor
• Alternate names: tumor necrosis factor receptor superfamily member 3, lymphotoxin B receptor, lymphotoxin beta receptor (TNFR superfamily, member 3), tumor necrosis factor C receptor, tumor necrosis factor receptor 2-related protein, tumor necrosis factor receptor type III,
• Gene location: 12p13.31 (6375159: 6391570)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during t
• OMIM: 603625

Protein Summary

• Protein general information: P36941  
  • Name: Tumor necrosis factor receptor superfamily member 3 (Lymphotoxin beta receptor) (Tumor necrosis factor C receptor) (Tumor necrosis factor receptor 2 related protein) (Tumor necrosis factor receptor type III) (TNF RIII) (TNFR III)
  • Length: 435  
  • Mass: 46709
• Sequence:

  MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRI
  RDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPP
  GTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTM
  LMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD
  VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGP
  GDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD

• Structural information:
  • Interpro: IPR001368  IPR017349  IPR033997  
  • Prosite: PS00652 PS50050
  • CDD: cd10578
  • PDB: 1RF3 4MXW
  • PDBsum: 1RF3 4MXW
  • DIP: 2928
  • STRING: ENSP00000228918
• Other Databases: GeneCards:  LTBR  Malacards:  LTBR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0048534	hematopoietic or lymphoid organ development	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043011	myeloid dendritic cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa05166	Human T-cell leukemia virus 1 infection
hsa05203	Viral carcinogenesis
hsa04064	NF-kappa B signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04066	HIF-1 signaling pathway
hsa04672	Intestinal immune network for IgA production

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq