• Gene id: 4051

Gene Summary

• Gene Symbol: CYP4F3   Gene   UCSC   Ensembl
• Aliases: CPF3, CYP4F, CYPIVF3, LTB4H
• Gene name: cytochrome P450 family 4 subfamily F member 3
• Alternate names: cytochrome P450 4F3, 20-HETE synthase, 20-hydroxyeicosatetraenoic acid synthase, cytochrome P-450, cytochrome P450, family 4, subfamily F, polypeptide 3, cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase), cytochrome P450-LTB-omega,
• Gene location: 19p13.12 (15640896: 15662824)     Exons: 15     NC_000019.10
• Gene summary(Entrez): This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot
• OMIM: 601270

Protein Summary

• Protein general information: Q08477  
  • Name: Cytochrome P450 4F3 (EC 1.14.14.1) (20 hydroxyeicosatetraenoic acid synthase) (20 HETE synthase) (CYPIVF3) (Cytochrome P450 LTB omega) (Docosahexaenoic acid omega hydroxylase CYP4F3) (EC 1.14.14.79) (Leukotriene B(4) 20 monooxygenase 2) (Leukotriene B(4)
  • Length: 520  
  • Mass: 59847
  • Tissue specificity: Isoform CYP4F3A is expressed in the polymorphonuclear leukocytes as well as leukocytes and bone marrow. Isoform CYP4F3B is selectively expressed in liver and kidney and is also the predominant CYP4F isoform in trachea and tissues of th
• Sequence:

  MPQLSLSSLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLL
  YTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRM
  LTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAI
  LELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID
  VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDL
  AQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNI
  KERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000221307
• Other Databases: GeneCards:  CYP4F3  Malacards:  CYP4F3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0050051	leukotriene-B4 20-monooxygenase activity	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0042376	phylloquinone catabolic process	IBA	biological process
GO:0042361	menaquinone catabolic process	IBA	biological process
GO:0008391	arachidonic acid monooxygenase activity	IBA	molecular function
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0042377	vitamin K catabolic process	IBA	biological process
GO:0036101	leukotriene B4 catabolic process	IBA	biological process
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004497	monooxygenase activity	TAS	molecular function
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0070330	aromatase activity	IEA	molecular function
GO:0050051	leukotriene-B4 20-monooxygenase activity	IEA	molecular function
GO:0006690	icosanoid metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0019369	arachidonic acid metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00590	Arachidonic acid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq