• Gene id: 4050

Gene Summary

• Gene Symbol: LTB   Gene   UCSC   Ensembl
• Aliases: TNFC, TNFSF3, TNLG1C, p33
• Gene name: lymphotoxin beta
• Alternate names: lymphotoxin-beta, LT-beta, TNF superfamily member 3, TNF-C, lymphotoxin beta (TNF superfamily, member 3), tumor necrosis factor C, tumor necrosis factor ligand 1C, tumor necrosis factor ligand superfamily member 3,
• Gene location: 6p21.33 (31582424: 31580557)     Exons: 4     NC_000006.12
• Gene summary(Entrez): Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule al
• OMIM: 600978

SNPs

rs4758680

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.122170805T>A
NC_000012.12   g.122170805T>G
NC_000012.11   g.122655352T>A
NC_000012.11   g.122655352T>G|SEQ=[T/A/G]|GENE=LRRC43

Protein Summary

• Protein general information: Q06643  
  • Name: Lymphotoxin beta (LT beta) (Tumor necrosis factor C) (TNF C) (Tumor necrosis factor ligand superfamily member 3)
  • Length: 244  
  • Mass: 25390
  • Tissue specificity: Spleen and thymus.
• Sequence:

  MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLP
  EEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGG
  DPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISH
  PDMVDFARGKTFFGAVMVG

• Structural information:
  • Interpro: IPR006053  IPR002961  IPR021184  IPR006052  IPR008983  
  • Prosite: PS00251 PS50049
  • CDD: cd00184
  • PDB: 4MXW
  • PDBsum: 4MXW
  • DIP: 2996
  • STRING: ENSP00000410481
• Other Databases: GeneCards:  LTB  Malacards:  LTB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0048535	lymph node development	IEA	biological process
GO:0043588	skin development	IEA	biological process
GO:0010467	gene expression	IEA	biological process
GO:0045084	positive regulation of interleukin-12 biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0045084	positive regulation of interleukin-12 biosynthetic process	ISS	biological process
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04064	NF-kappa B signaling pathway
hsa05323	Rheumatoid arthritis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)