• Gene id: 4049

Gene Summary

• Gene Symbol: LTA   Gene   UCSC   Ensembl
• Aliases: LT, TNFB, TNFSF1, TNLG1E
• Gene name: lymphotoxin alpha
• Alternate names: lymphotoxin-alpha, LT-alpha, TNF superfamily, member 1, TNF-beta, truncated lymphotoxin alpha, tumor necrosis factor beta, tumor necrosis factor ligand 1E, tumor necrosis factor ligand superfamily member 1,
• Gene location: 6p21.33 (31560549: 31574323)     Exons: 8     NC_000006.12
• Gene summary(Entrez): The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This pro
• OMIM: 614697

SNPs

rs1799964

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31574531T>C
NC_000006.11   g.31542308T>C
NG_007462.1   g.3959T>C
NG_012010.1   g.7433T>C
NT_113891.3   g.3051818T>C
NT_113891.2   g.3051924T>C
NT_167246.2   g.2879572T>C
NT_167246.1   g.2885192T>C
NT_167249.2   g.2873811T>C
NT_167249.1   g.2873109T>C
NT  

rs1799724

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31574705C>T
NC_000006.11   g.31542482C>T
NG_007462.1   g.4133C>T
NG_012010.1   g.7607C>T
NT_113891.3   g.3051992C>T
NT_113891.2   g.3052098C>T
NT_167246.2   g.2879746C>T
NT_167246.1   g.2885366C>T
NT_167249.2   g.2873985C>T
NT_167249.1   g.2873283C>T
NT  

Protein Summary

• Protein general information: P01374  
  • Name: Lymphotoxin alpha (LT alpha) (TNF beta) (Tumor necrosis factor ligand superfamily member 1)
  • Length: 205  
  • Mass: 22297
• Sequence:

  MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQN
  SLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLS
  SQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

• Structural information:
  • Interpro: IPR006053  IPR002960  IPR021184  IPR006052  IPR008983  
  • Prosite: PS00251 PS50049
  • CDD: cd00184
  • PDB: 1TNR 4MXV 4MXW
  • PDBsum: 1TNR 4MXV 4MXW
  • DIP: 2910
  • STRING: ENSP00000403495
• Other Databases: GeneCards:  LTA  Malacards:  LTA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0006915	apoptotic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0048535	lymph node development	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0007584	response to nutrient	IEA	biological process
GO:0060252	positive regulation of glial cell proliferation	IEA	biological process
GO:0002876	positive regulation of chronic inflammatory response to antigenic stimulus	IEA	biological process
GO:0002925	positive regulation of humoral immune response mediated by circulating immunoglobulin	IEA	biological process
GO:0006959	humoral immune response	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04060	Cytokine-cytokine receptor interaction
hsa05166	Human T-cell leukemia virus 1 infection
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04940	Type I diabetes mellitus

Diseases

Associated diseases	References
Adult respiratory distress syndrome	PMID:16135717
Graves' disease	PMID:1346144
Sjogren's syndrome	PMID:20952683
Sjogren's syndrome	PMID:22294627
pulmonary sarcoidosis	PMID:15713215
Endometrial cancer	PMID:17045328
Cystic fibrosis	PMID:21993476
Breast cancer	PMID:11841482
Breast cancer	PMID:18409070
Melanoma	PMID:9182821
Hyperinsulinism	PMID:9726033
Asthma	PMID:18947013
Malignant glioma	PMID:1883913
Coronary artery disease	PMID:15973460
Carotid artery disease	PMID:17065682
Cerebral infarction	PMID:14593215
lung non-small cell carcinoma	PMID:9669810
systemic scleroderma	PMID:10600011
Pustulosis of palm and sole	PMID:12691703
Myocardial infarction	PMID:12426569
Dermatitis herpetiformis	PMID:7914110
Psoriasis	PMID:12709814
Diabetic retinopathy	PMID:11399938
Psoriatic arthritis	PMID:22480318
type 2 diabetes mellitus	PMID:15729581
Neovascular inflammatory vitreoretinopathy	PMID:20663564
type 1 diabetes mellitus	PMID:9342542
type 1 diabetes mellitus	PMID:8242903
type 1 diabetes mellitus	PMID:11141334
type 1 diabetes mellitus	PMID:17989340
type 1 diabetes mellitus	PMID:19120272
type 1 diabetes mellitus	PMID:12622777
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R