About Us

Search Result


Gene id 404672
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol GTF2H5   Gene   UCSC   Ensembl
Aliases C6orf175, TFB5, TFIIH, TGF2H5, TTD, TTD-A, TTD3, TTDA, bA120J8.2
Gene name general transcription factor IIH subunit 5
Alternate names general transcription factor IIH subunit 5, TFB5 ortholog, TFIIH basal transcription factor complex TTD-A subunit, TFIIH basal transcription factor complex TTDA subunit, general transcription factor IIH, polypeptide 5,
Gene location 6q25.3 (158168315: 158199343)     Exons: 3     NC_000006.12
Gene summary(Entrez) This gene encodes a subunit of transcription/repair factor TFIIH, which functions in gene transcription and DNA repair. This protein stimulates ERCC3/XPB ATPase activity to trigger DNA opening during DNA repair, and is implicated in regulating cellular le
OMIM 605220

Protein Summary

Protein general information Q6ZYL4  

Name: General transcription factor IIH subunit 5 (General transcription factor IIH polypeptide 5) (TFB5 ortholog) (TFIIH basal transcription factor complex TTD A subunit)

Length: 71  Mass: 8053

Sequence MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK
Structural information
Interpro:  IPR035935  IPR009400  

PDB:  
1YDL 2JNJ 5IVW 5IY6 5IY7 5IY8 5IY9 5OF4 6NMI 6O9L 6O9M 6RO4
PDBsum:   1YDL 2JNJ 5IVW 5IY6 5IY7 5IY8 5IY9 5OF4 6NMI 6O9L 6O9M 6RO4

DIP:  

29188

STRING:   ENSP00000476100
Other Databases GeneCards:  GTF2H5  Malacards:  GTF2H5

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005669 transcription factor TFII
D complex
IBA cellular component
GO:0005675 transcription factor TFII
H holo complex
IBA cellular component
GO:0006289 nucleotide-excision repai
r
IBA biological process
GO:0006294 nucleotide-excision repai
r, preincision complex as
sembly
IBA biological process
GO:0006366 transcription by RNA poly
merase II
IBA biological process
GO:0000439 transcription factor TFII
H core complex
IBA cellular component
GO:0070816 phosphorylation of RNA po
lymerase II C-terminal do
main
IBA biological process
GO:0005669 transcription factor TFII
D complex
IDA cellular component
GO:0006289 nucleotide-excision repai
r
IEA biological process
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
IEA biological process
GO:0000439 transcription factor TFII
H core complex
IEA cellular component
GO:0006281 DNA repair
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0006974 cellular response to DNA
damage stimulus
IEA biological process
GO:0005730 nucleolus
IDA cellular component
GO:0006289 nucleotide-excision repai
r
IMP biological process
GO:0006283 transcription-coupled nuc
leotide-excision repair
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006368 transcription elongation
from RNA polymerase II pr
omoter
TAS biological process
GO:0033683 nucleotide-excision repai
r, DNA incision
TAS biological process
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0006293 nucleotide-excision repai
r, preincision complex st
abilization
TAS biological process
GO:0006294 nucleotide-excision repai
r, preincision complex as
sembly
TAS biological process
GO:0006294 nucleotide-excision repai
r, preincision complex as
sembly
TAS biological process
GO:0006294 nucleotide-excision repai
r, preincision complex as
sembly
TAS biological process
GO:0006295 nucleotide-excision repai
r, DNA incision, 3'-to le
sion
TAS biological process
GO:0006296 nucleotide-excision repai
r, DNA incision, 5'-to le
sion
TAS biological process
GO:0006361 transcription initiation
from RNA polymerase I pro
moter
TAS biological process
GO:0006361 transcription initiation
from RNA polymerase I pro
moter
TAS biological process
GO:0006362 transcription elongation
from RNA polymerase I pro
moter
TAS biological process
GO:0006363 termination of RNA polyme
rase I transcription
TAS biological process
GO:0006366 transcription by RNA poly
merase II
TAS biological process
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
TAS biological process
GO:0006370 7-methylguanosine mRNA ca
pping
TAS biological process
GO:0070911 global genome nucleotide-
excision repair
TAS biological process
GO:0000717 nucleotide-excision repai
r, DNA duplex unwinding
TAS biological process
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0071480 cellular response to gamm
a radiation
IEA biological process
GO:0006362 transcription elongation
from RNA polymerase I pro
moter
IEA biological process
GO:0006294 nucleotide-excision repai
r, preincision complex as
sembly
IEA biological process
GO:0006289 nucleotide-excision repai
r
IEA biological process
GO:0000462 maturation of SSU-rRNA fr
om tricistronic rRNA tran
script (SSU-rRNA, 5.8S rR
NA, LSU-rRNA)
IEA biological process
GO:0005634 nucleus
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03022Basal transcription factors
hsa03420Nucleotide excision repair
Associated diseases References
Disorders of nucleotide excision repair KEGG:H00403
Trichothiodystrophy KEGG:H00866
Disorders of nucleotide excision repair KEGG:H00403
Trichothiodystrophy KEGG:H00866
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract