• Gene id: 404636

Gene Summary

• Gene Symbol: DENND10   Gene   UCSC   Ensembl
• Aliases: FAM45A
• Gene name: DENN domain containing 10
• Alternate names: DENN domain-containing protein 10, family with sequence similarity 45 member A, protein FAM45A,
• Gene location: 10q26.11 (119104081: 119137983)     Exons: 10     NC_000010.11
• OMIM: 300713

Protein Summary

• Protein general information: Q8TCE6  
  • Name: DENN domain containing protein 10 (Protein FAM45A)
  • Length: 357  
  • Mass: 40513
• Sequence:

  MAAAEVADTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFVFGQYRRTWFYITTIE
  VPDSSILKKVTHFSIVLTAKDFNPEKYAAFTRILCRMYLKHGSPVKMMESYIAVLTKGICQSEENGSFLSKDFDA
  RKAYLAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYVHLNADELE
  ALQMCTGYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQD
  IALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI

• Structural information:
  • Protein Domains: (1..14-)
    (/note="uDENN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00304-)
    (165..29-)
    (/note="cDENN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00304-)
    (301..35-)
    (/note="dDENN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00304"-)
  • Interpro: IPR042431  IPR037516  
  • Prosite: PS50211
  • STRING: ENSP00000354688
• Other Databases: GeneCards:  DENND10  Malacards:  DENND10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005085	guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0005770	late endosome	IDA	cellular component
GO:2000641	regulation of early endosome to late endosome transport	IMP	biological process
GO:0005623	obsolete cell	IMP	cellular component
GO:0032509	endosome transport via multivesicular body sorting pathway	IMP	biological process
GO:0015031	protein transport	IMP	biological process
GO:0031267	small GTPase binding	IPI	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005770	late endosome	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881